PDB entry 1xto

View 1xto on RCSB PDB site
Description: crystal structure of the coenzyme pqq synthesis protein (pqqb) from pseudomonas putida, northeast structural genomics target ppr6
Deposited on 2004-10-22, released 2004-11-09
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-09, with a file datestamp of 2004-11-09.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.227
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xtoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xtoA (A:)
    myiqvlgsaagggfpqwncncvnckgyrdgtlkatartqssialsddgvhwilcnaspdi
    raqlqafapmqparalrdtginaivlldsqidhttgllslregcphqvwctdmvhqdltt
    gfplfnmlshwngglqwnrielegsfvidacpnlkftpfplrsaappysphrfdphpgdn
    lglmvedtrtggklfyapglgqvdekllammhgadcllvdgtlweddemqrrgvgtrtgr
    emghlaqngpggmlevldgfprqrkvlihinntnpildensperaevlrrgvevafdgms
    iellehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtoA (A:)
    myiqvlgsaagggfpqwncncvnckgyrdgtlkatartqssialsddgvhwilcnaspdi
    raqlqafapmqparalrdtginaivlldsqidhttgllslregcphqvwctdmvhqdltt
    gfplfnmlshwngglqwnrielegsfvidacpnlkftpfplrsaappysphrfdphpgdn
    lglmvedtrtggklfyapglgqvdekllammhgadcllvdgtlweddemqrrgvgtrtgr
    emghlaqngpggmlevldgfprqrkvlihinntnpildensperaevlrrgvevafdgms
    iell