PDB entry 1xtl

View 1xtl on RCSB PDB site
Description: Crystal structure of P104H mutant of SOD-like protein from Bacillus subtilis.
Class: structural genomics, unknown function
Keywords: SOD, Cu-Zn SOD, SOD-like, superoxide dismutase mutants, structural genomics, UNKNOWN FUNCTION
Deposited on 2004-10-22, released 2005-10-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.237
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical superoxide dismutase-like protein yojM
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31851
      • engineered (82)
    Domains in SCOPe 2.07: d1xtla_
  • Chain 'B':
    Compound: Hypothetical superoxide dismutase-like protein yojM
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31851
      • engineered (82)
    Domains in SCOPe 2.07: d1xtlb_
  • Chain 'C':
    Compound: Hypothetical superoxide dismutase-like protein yojM
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31851
      • engineered (82)
    Domains in SCOPe 2.07: d1xtlc_
  • Chain 'D':
    Compound: Hypothetical superoxide dismutase-like protein yojM
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31851
      • engineered (82)
    Domains in SCOPe 2.07: d1xtld_
  • Heterogens: CU, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xtlA (A:)
    kppdppnrvpekkvvetsafghhvqlvnregkavgfieikesddegldihisanslrpga
    slgfhiyekgscvrpdfesagghfnplnkehgfnnpmghhagdlpnlevgadgkvdvimn
    apdtslkkgsklnildedgsafiiheqaddyltnpsgnsgarivcgallgnnekq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtlA (A:)
    afghhvqlvnregkavgfieikesddegldihisanslrpgaslgfhiyekgscvrpdfe
    sagghfnplnkehgfnnpmghhagdlpnlevgadgkvdvimnapdtslkkgsklnilded
    gsafiiheqaddyltnpsgnsgarivcgallg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xtlB (B:)
    kppdppnrvpekkvvetsafghhvqlvnregkavgfieikesddegldihisanslrpga
    slgfhiyekgscvrpdfesagghfnplnkehgfnnpmghhagdlpnlevgadgkvdvimn
    apdtslkkgsklnildedgsafiiheqaddyltnpsgnsgarivcgallgnnekq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtlB (B:)
    afghhvqlvnregkavgfieikesddegldihisanslrpgaslgfhiyekgscvrpdfe
    sagghfnplnkehgfnnpmghhagdlpnlevgadgkvdvimnapdtslkkgsklnilded
    gsafiiheqaddyltnpsgnsgarivcgallg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xtlC (C:)
    kppdppnrvpekkvvetsafghhvqlvnregkavgfieikesddegldihisanslrpga
    slgfhiyekgscvrpdfesagghfnplnkehgfnnpmghhagdlpnlevgadgkvdvimn
    apdtslkkgsklnildedgsafiiheqaddyltnpsgnsgarivcgallgnnekq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtlC (C:)
    afghhvqlvnregkavgfieikesddegldihisanslrpgaslgfhiyekgscvrpdfe
    sagghfnplnkehgfnnpmghhagdlpnlevgadgkvdvimnapdtslkkgsklnilded
    gsafiiheqaddyltnpsgnsgarivcgallg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xtlD (D:)
    kppdppnrvpekkvvetsafghhvqlvnregkavgfieikesddegldihisanslrpga
    slgfhiyekgscvrpdfesagghfnplnkehgfnnpmghhagdlpnlevgadgkvdvimn
    apdtslkkgsklnildedgsafiiheqaddyltnpsgnsgarivcgallgnnekq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtlD (D:)
    afghhvqlvnregkavgfieikesddegldihisanslrpgaslgfhiyekgscvrpdfe
    sagghfnplnkehgfnnpmghhagdlpnlevgadgkvdvimnapdtslkkgsklnilded
    gsafiiheqaddyltnpsgnsgarivcgallg