PDB entry 1xti

View 1xti on RCSB PDB site
Description: Structure of Wildtype human UAP56
Class: gene regulation
Keywords: alpha-beta fold, GENE REGULATION
Deposited on 2004-10-21, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.218
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable ATP-dependent RNA helicase p47
    Species: Homo sapiens [TaxId:9606]
    Gene: BAT1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtia1, d1xtia2
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xtiA (A:)
    gspghmssgfrdfllkpellraivdcgfehpsevqhecipqailgmdvlcqaksgmgkta
    vfvlatlqqlepvtgqvsvlvmchtrelafqiskeyerfskympnvkvavffgglsikkd
    eevlkkncphivvgtpgrilalarnkslnlkhikhfildecdkmleqldmrrdvqeifrm
    tphekqvmmfsatlskeirpvcrkfmqdpmeifvddetkltlhglqqyyvklkdneknrk
    lfdlldvlefnqvvifvksvqrcialaqllveqnfpaiaihrgmpqeerlsryqqfkdfq
    rrilvatnlfgrgmdiervniafnydmpedsdtylhrvaragrfgtkglaitfvsdenda
    kilndvqdrfevniselpdeidissyieqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtiA (A:)
    gfrdfllkpellraivdcgfehpsevqhecipqailgmdvlcqaksgmgktavfvlatlq
    qlepvtgqvsvlvmchtrelafqiskeyerfskympnvkvavffgglsikkdeevlkknc
    phivvgtpgrilalarnkslnlkhikhfildecdkmleqldmrrdvqeifrmtphekqvm
    mfsatlskeirpvcrkfmqdpmeifvddetkltlhglqqyyvklkdneknrklfdlldvl
    efnqvvifvksvqrcialaqllveqnfpaiaihrgmpqeerlsryqqfkdfqrrilvatn
    lfgrgmdiervniafnydmpedsdtylhrvaragrfgtkglaitfvsdendakilndvqd
    rfevniselpdeidissyieq