PDB entry 1xtf

View 1xtf on RCSB PDB site
Description: neurotoxin bont/a e224q y366f mutant
Deposited on 2004-10-21, released 2004-12-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-21, with a file datestamp of 2004-12-21.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.22
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xtfa_
  • Chain 'B':
    Domains in SCOP 1.71: d1xtfb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtfA (A:)
    pfvnkqfnykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnp
    ppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggs
    tidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngyg
    stqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahqlihaghrlygiainpnr
    vfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkak
    sivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvl
    nrktflnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknftp
    ghhhhhh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtfB (B:)
    pfvnkqfnykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnp
    ppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggs
    tidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngyg
    stqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahqlihaghrlygiainpnr
    vfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkak
    sivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvl
    nrktflnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknftp
    ghhhhhh