PDB entry 1xtf

View 1xtf on RCSB PDB site
Description: neurotoxin BoNT/A E224Q Y366F mutant
Class: toxin
Keywords: Zinc endopeptidase, neurotoxin, botulism
Deposited on 2004-10-21, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.22
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurotoxin BoNT/A
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • GB AAQ06331
      • engineered (222)
      • engineered (364)
      • cloning artifact (419-420)
      • expression tag (421-426)
    Domains in SCOPe 2.07: d1xtfa1, d1xtfa2
  • Chain 'B':
    Compound: Neurotoxin BoNT/A
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • GB AAQ06331 (0-418)
      • engineered (222)
      • engineered (364)
      • cloning artifact (419-420)
      • expression tag (421-426)
    Domains in SCOPe 2.07: d1xtfb1, d1xtfb2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtfA (A:)
    pfvnkqfnykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnp
    ppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggs
    tidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngyg
    stqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahqlihaghrlygiainpnr
    vfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkak
    sivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvl
    nrktflnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknftp
    ghhhhhh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtfB (B:)
    pfvnkqfnykdpvngvdiayikipnagqmqpvkafkihnkiwviperdtftnpeegdlnp
    ppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggs
    tidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngyg
    stqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahqlihaghrlygiainpnr
    vfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnkak
    sivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkvl
    nrktflnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklknftp
    ghhhhhh