PDB entry 1xte

View 1xte on RCSB PDB site
Description: crystal structure of CISK-PX domain
Class: transferase
Keywords: CISK, PX domain, TRANSFERASE
Deposited on 2004-10-21, released 2004-11-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Sgk3
    Species: Mus musculus [TaxId:10090]
    Gene: Cisk
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xtea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xteA (A:)
    mdykescpsvsipssdehrekkkrftvykvlvsvgrsewfvfrryaefdklynslkkqfp
    amalkipakrifgdnfdpdfikqrraglnefiqnlvrypelynhpdvraflqmdsprhqs
    dpsedederstskphstsrninlgptgnphakpt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xteA (A:)
    kescpsvsipssdehrekkkrftvykvlvsvgrsewfvfrryaefdklynslkkqfpama
    lkipakrifgdnfdpdfikqrraglnefiqnlvrypelynhpdvraflqmdsprhq