PDB entry 1xtd

View 1xtd on RCSB PDB site
Description: Structural Analysis of Leishmania mexicana eukaryotic initiation factor 5a
Class: translation
Keywords: SGPP, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, Structural Genomics of Pathogenic Protozoa Consortium, TRANSLATION
Deposited on 2004-10-21, released 2004-10-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.225
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eukaryotic initiation factor 5a
    Species: Leishmania mexicana [TaxId:5665]
    Database cross-references and differences (RAF-indexed):
    • PDB 1XTD
    Domains in SCOPe 2.05: d1xtda1, d1xtda2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xtdA (A:)
    mahhhhhhmsdedhdfahqgggdnasktypmaagalkkggyvcingrpckvidlsvsktg
    khghakvsivatdiftgnrledqapsthnvevpfvktftysvldiqpnedpslpshlslm
    ddegesredldmppdaalatqikeqfdsgkevlvvvvsamgteqvlqtknaaek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtdA (A:)
    nasktypmaagalkkggyvcingrpckvidlsvsktgkhghakvsivatdiftgnrledq
    apsthnvevpfvktftysvldiqpnedpslpshlslmddegesredldmppdaalatqik
    eqfdsgkevlvvvvsamgteqvlqtknaa