PDB entry 1xtc

View 1xtc on RCSB PDB site
Description: cholera toxin
Deposited on 1996-01-10, released 1996-08-01
The last revision prior to the SCOP 1.65 freeze date was dated 1996-08-01, with a file datestamp of 1996-08-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.185
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1xtc.1
  • Chain 'C':
    Domains in SCOP 1.65: d1xtc.1
  • Chain 'D':
    Domains in SCOP 1.65: d1xtcd_
  • Chain 'E':
    Domains in SCOP 1.65: d1xtce_
  • Chain 'F':
    Domains in SCOP 1.65: d1xtcf_
  • Chain 'G':
    Domains in SCOP 1.65: d1xtcg_
  • Chain 'H':
    Domains in SCOP 1.65: d1xtch_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xtcA (A:)
    nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyv
    stsislrsahlvgqtilsghstyylyvlatapnmfnvndvlgaysphpdeqevsalggip
    ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
    hhappgcgnaprss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtcA (A:)
    nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyv
    stsislrsahlvgqtilsghstyylyvlatapnmfnvndvlgaysphpdeqevsalggip
    ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
    hhappgcgnapr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xtcC (C:)
    msntcdektqslgvkfldeyqskvkrqifsgyqsdidthnrikdel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtcC (C:)
    sntcdektqslgvkfldeyqskvkrqifsgyqsdidthnrikdel
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtcD (D:)
    tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpssqhids
    qkkaiermkdtlriaylteakveklctwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtcE (E:)
    tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpssqhids
    qkkaiermkdtlriaylteakveklctwnnktphaiaaisman
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtcF (F:)
    tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpssqhids
    qkkaiermkdtlriaylteakveklctwnnktphaiaaisman
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtcG (G:)
    tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpssqhids
    qkkaiermkdtlriaylteakveklctwnnktphaiaaisman
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtcH (H:)
    tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpssqhids
    qkkaiermkdtlriaylteakveklctwnnktphaiaaisman