PDB entry 1xtc

View 1xtc on RCSB PDB site
Description: cholera toxin
Class: toxin
Keywords: enterotoxin, toxin
Deposited on 1996-01-10, released 1996-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.185
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cholera toxin
    Species: Vibrio cholerae [TaxId:44104]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01555 (0-End)
      • conflict (84)
      • conflict (87)
    Domains in SCOPe 2.07: d1xtc.1
  • Chain 'C':
    Compound: cholera toxin
    Species: Vibrio cholerae [TaxId:44104]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xtc.1
  • Chain 'D':
    Compound: cholera toxin
    Species: Vibrio cholerae [TaxId:44104]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (53)
      • conflict (86)
    Domains in SCOPe 2.07: d1xtcd_
  • Chain 'E':
    Compound: cholera toxin
    Species: Vibrio cholerae [TaxId:44104]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (53)
      • conflict (86)
    Domains in SCOPe 2.07: d1xtce_
  • Chain 'F':
    Compound: cholera toxin
    Species: Vibrio cholerae [TaxId:44104]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (53)
      • conflict (86)
    Domains in SCOPe 2.07: d1xtcf_
  • Chain 'G':
    Compound: cholera toxin
    Species: Vibrio cholerae [TaxId:44104]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (53)
      • conflict (86)
    Domains in SCOPe 2.07: d1xtcg_
  • Chain 'H':
    Compound: cholera toxin
    Species: Vibrio cholerae [TaxId:44104]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01556 (0-102)
      • conflict (53)
      • conflict (86)
    Domains in SCOPe 2.07: d1xtch_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xtcA (A:)
    nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyv
    stsislrsahlvgqtilsghstyylyvlatapnmfnvndvlgaysphpdeqevsalggip
    ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
    hhappgcgnaprss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtcA (A:)
    nddklyradsrppdeikqsgglmprgqseyfdrgtqmninlydhargtqtgfvrhddgyv
    stsislrsahlvgqtilsghstyylyvlatapnmfnvndvlgaysphpdeqevsalggip
    ysqiygwyrvhfgvldeqlhrnrgyrdryysnldiapaadgyglagfppehrawreepwi
    hhappgcgnapr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xtcC (C:)
    msntcdektqslgvkfldeyqskvkrqifsgyqsdidthnrikdel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtcC (C:)
    sntcdektqslgvkfldeyqskvkrqifsgyqsdidthnrikdel
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtcD (D:)
    tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpssqhids
    qkkaiermkdtlriaylteakveklctwnnktphaiaaisman
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtcE (E:)
    tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpssqhids
    qkkaiermkdtlriaylteakveklctwnnktphaiaaisman
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtcF (F:)
    tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpssqhids
    qkkaiermkdtlriaylteakveklctwnnktphaiaaisman
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtcG (G:)
    tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpssqhids
    qkkaiermkdtlriaylteakveklctwnnktphaiaaisman
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xtcH (H:)
    tpqnitdlcaeyhntqiytlndkifsyteslagkremaiitfkngaifqvevpssqhids
    qkkaiermkdtlriaylteakveklctwnnktphaiaaisman