PDB entry 1xtb

View 1xtb on RCSB PDB site
Description: Crystal Structure of Rabbit Phosphoglucose Isomerase Complexed with Sorbitol-6-Phosphate
Class: isomerase
Keywords: Phosphoglucose Isomerase, Glucose-6-phosphate isomerase, ISOMERASE
Deposited on 2004-10-21, released 2005-03-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglucose isomerase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xtba_
  • Chain 'B':
    Compound: phosphoglucose isomerase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xtbb_
  • Heterogens: S6P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xtbA (A:)
    maaltrnpqfqklqqwhrehgselnlrhlfdtdkerfnhfsltlntnhghilldysknlv
    teevmhmlldlaksrgveaaresmfngekinstedravlhvalrnrsntpivvdgkdvmp
    evnkvldkmkafcqrvrsgdwkgytgktitdvinigiggsdlgplmvtealkpyssggpr
    vwfvsnidgthiaktlaclnpesslfiiasktfttqetitnaktakdwfllsakdpstva
    khfvalstntakvkefgidpqnmfefwdwvggryslwsaiglsialhvgfdnfeqllsga
    hwmdqhfrttpleknapvllamlgiwyincfgcetqavlpydqylhrfaayfqqgdmesn
    gkyitksgarvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkgl
    hhkillanflaqtealmkgksteearkelqaagkspedlmkllphkvfegnrptnsivft
    kltpfilgaliamyehkifvqgvvwdinsfdqwgvelgkqlakkiepeldgsspvtshds
    stnglinfikqqreakiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtbA (A:)
    aaltrnpqfqklqqwhrehgselnlrhlfdtdkerfnhfsltlntnhghilldysknlvt
    eevmhmlldlaksrgveaaresmfngekinstedravlhvalrnrsntpivvdgkdvmpe
    vnkvldkmkafcqrvrsgdwkgytgktitdvinigiggsdlgplmvtealkpyssggprv
    wfvsnidgthiaktlaclnpesslfiiasktfttqetitnaktakdwfllsakdpstvak
    hfvalstntakvkefgidpqnmfefwdwvggryslwsaiglsialhvgfdnfeqllsgah
    wmdqhfrttpleknapvllamlgiwyincfgcetqavlpydqylhrfaayfqqgdmesng
    kyitksgarvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkglh
    hkillanflaqtealmkgksteearkelqaagkspedlmkllphkvfegnrptnsivftk
    ltpfilgaliamyehkifvqgvvwdinsfdqwgvelgkqlakkiepeldgsspvtshdss
    tnglinfikqqreaki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xtbB (B:)
    maaltrnpqfqklqqwhrehgselnlrhlfdtdkerfnhfsltlntnhghilldysknlv
    teevmhmlldlaksrgveaaresmfngekinstedravlhvalrnrsntpivvdgkdvmp
    evnkvldkmkafcqrvrsgdwkgytgktitdvinigiggsdlgplmvtealkpyssggpr
    vwfvsnidgthiaktlaclnpesslfiiasktfttqetitnaktakdwfllsakdpstva
    khfvalstntakvkefgidpqnmfefwdwvggryslwsaiglsialhvgfdnfeqllsga
    hwmdqhfrttpleknapvllamlgiwyincfgcetqavlpydqylhrfaayfqqgdmesn
    gkyitksgarvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkgl
    hhkillanflaqtealmkgksteearkelqaagkspedlmkllphkvfegnrptnsivft
    kltpfilgaliamyehkifvqgvvwdinsfdqwgvelgkqlakkiepeldgsspvtshds
    stnglinfikqqreakiq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xtbB (B:)
    aaltrnpqfqklqqwhrehgselnlrhlfdtdkerfnhfsltlntnhghilldysknlvt
    eevmhmlldlaksrgveaaresmfngekinstedravlhvalrnrsntpivvdgkdvmpe
    vnkvldkmkafcqrvrsgdwkgytgktitdvinigiggsdlgplmvtealkpyssggprv
    wfvsnidgthiaktlaclnpesslfiiasktfttqetitnaktakdwfllsakdpstvak
    hfvalstntakvkefgidpqnmfefwdwvggryslwsaiglsialhvgfdnfeqllsgah
    wmdqhfrttpleknapvllamlgiwyincfgcetqavlpydqylhrfaayfqqgdmesng
    kyitksgarvdhqtgpivwgepgtngqhafyqlihqgtkmipcdflipvqtqhpirkglh
    hkillanflaqtealmkgksteearkelqaagkspedlmkllphkvfegnrptnsivftk
    ltpfilgaliamyehkifvqgvvwdinsfdqwgvelgkqlakkiepeldgsspvtshdss
    tnglinfikqqreaki