PDB entry 1xt9

View 1xt9 on RCSB PDB site
Description: Crystal Structure of Den1 in complex with Nedd8
Class: hydrolase/hydrolase inhibitor
Keywords: Cysteine protease, ubiquitin-like, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on 2004-10-21, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sentrin-specific protease 8
    Species: Homo sapiens [TaxId:9606]
    Gene: SENP8, FKSG8, PRSC2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xt9a_
  • Chain 'B':
    Compound: Neddylin
    Species: Homo sapiens [TaxId:9606]
    Gene: NEDD8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xt9b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xt9A (A:)
    mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdcsdhvsfispevtq
    fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggthwsllvylqdknsffhyds
    hsrsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffr
    qqtesllqlltpayitkkrgewkdlittlakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xt9A (A:)
    dpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdcsdhvsfispevtqf
    ikctsneiamflepldlpnkrvvflaindnsnqaaggthwsllvylqdknsffhydshsr
    snsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffrqqt
    esllqlltpayitkkrgewkdlittlak
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xt9B (B:)
    mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
    ilggsvlhlvlalrgg