PDB entry 1xt8

View 1xt8 on RCSB PDB site
Description: Crystal Structure of Cysteine-Binding Protein from Campylobacter jejuni at 2.0 A Resolution
Class: transport protein
Keywords: ABC transport, cysteine uptake, amino-acid transporter periplasmic solute-binding protein, Campylobacter jejuni, SPINE, Structural Genomics, Structural Proteomics in Europe, TRANSPORT PROTEIN
Deposited on 2004-10-21, released 2005-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative amino-acid transporter periplasmic solute-binding protein
    Species: Campylobacter jejuni [TaxId:197]
    Gene: Cj0982c
    Database cross-references and differences (RAF-indexed):
    • GB NP_282132
    Domains in SCOPe 2.07: d1xt8a1
  • Chain 'B':
    Compound: putative amino-acid transporter periplasmic solute-binding protein
    Species: Campylobacter jejuni [TaxId:197]
    Gene: Cj0982c
    Database cross-references and differences (RAF-indexed):
    • GB NP_282132
    Domains in SCOPe 2.07: d1xt8b_
  • Heterogens: CYS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xt8A (A:)
    mkyllptaaagllllaaqpamamasggnsdsktlnsldkikqngvvrigvfgdkppfgyv
    dekgnnqgydialakriakelfgdenkvqfvlveaanrveflksnkvdiilanftqtpqr
    aeqvdfcspymkvalgvavpkdsnitsvedlkdktlllnkgttadayftqnypniktlky
    dqntetfaalmdkrgdalshdntllfawvkdhpdfkmgikelgnkdviapavkkgdkelk
    efidnliiklgqeqffhkaydetlkahfgddvkaddvvieggkilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xt8A (A:)
    lnsldkikqngvvrigvfgdkppfgyvdekgnnqgydialakriakelfgdenkvqfvlv
    eaanrveflksnkvdiilanftqtpqraeqvdfcspymkvalgvavpkdsnitsvedlkd
    ktlllnkgttadayftqnypniktlkydqntetfaalmdkrgdalshdntllfawvkdhp
    dfkmgikelgnkdviapavkkgdkelkefidnliiklgqeqffhkaydetlkahfgddvk
    addvvieg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xt8B (B:)
    mkyllptaaagllllaaqpamamasggnsdsktlnsldkikqngvvrigvfgdkppfgyv
    dekgnnqgydialakriakelfgdenkvqfvlveaanrveflksnkvdiilanftqtpqr
    aeqvdfcspymkvalgvavpkdsnitsvedlkdktlllnkgttadayftqnypniktlky
    dqntetfaalmdkrgdalshdntllfawvkdhpdfkmgikelgnkdviapavkkgdkelk
    efidnliiklgqeqffhkaydetlkahfgddvkaddvvieggkilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xt8B (B:)
    sktlnsldkikqngvvrigvfgdkppfgyvdekgnnqgydialakriakelfgdenkvqf
    vlveaanrveflksnkvdiilanftqtpqraeqvdfcspymkvalgvavpkdsnitsved
    lkdktlllnkgttadayftqnypniktlkydqntetfaalmdkrgdalshdntllfawvk
    dhpdfkmgikelgnkdviapavkkgdkelkefidnliiklgqeqffhkaydetlkahfgd
    dvkaddvvieg