PDB entry 1xt6

View 1xt6 on RCSB PDB site
Description: S35C Flavodoxin Mutant in the semiquinone state
Class: electron transport
Keywords: protein, flavodoxin, mutant, s35c, electron transport
Deposited on 2004-10-21, released 2004-12-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: flavodoxin
    Species: Desulfovibrio vulgaris subsp. vulgaris [TaxId:882]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00323 (0-146)
      • conflict (0)
      • engineered (33)
    Domains in SCOPe 2.01: d1xt6a_
  • Heterogens: FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xt6A (A:)
    akalivygsttgnteytaetiareladagyevdcrdaasveagglfegfdlvllgcstwg
    ddsielqddfiplfdsleetgaqgrkvacfgcgdssyeyfcgavdaieeklknlgaeivq
    dglridgdpraarddivgwahdvrgai