PDB entry 1xt5

View 1xt5 on RCSB PDB site
Description: Crystal Structure of VCBP3, domain 1, from Branchiostoma floridae
Deposited on 2004-10-21, released 2005-10-04
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: 0.128
AEROSPACI score: 0.89 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: variable region-containing chitin-binding protein 3
    Species: Branchiostoma floridae [TaxId:7739]
    Gene: VCBP3
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1xt5A (A:)
    gqsimtvrtthtevevhaggtvelpcsyqlandtqppviswlkgaspdrstkvfkgnynw
    qgeglgfvesdsykesfgdflgrasvanlaaptlrlthvhpqdggrywcqvaqwsirtef
    gldaksvvlkvtght