PDB entry 1xt0

View 1xt0 on RCSB PDB site
Description: The Structure of N-terminal Sec7 domain of RalF
Class: signaling protein
Keywords: The N-terminal Sec7 domain of RalF, SIGNALING PROTEIN
Deposited on 2004-10-20, released 2004-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.16 Å
R-factor: 0.215
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: guanine nucleotide exchange protein
    Species: Legionella pneumophila [TaxId:446]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RT31 (3-202)
      • cloning artifact (0-2)
      • modified residue (81)
      • modified residue (142)
      • modified residue (158)
    Domains in SCOPe 2.08: d1xt0b1, d1xt0b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xt0B (B:)
gashpeiekaqreiieafnakpknginkikeiceqykispneeiaeffhqqrknldleav
gdylsspeaenqqvlkaftsqmnfngqsfveglrtflktfklpgeaqkidrlvqsfsgay
fqqnpdvvsnadaayllafqtimlntdlhnpsipeknkmtvdglkrnlrggnnggdfdak
fleelyseikakpfelnfvktsp