PDB entry 1xsz

View 1xsz on RCSB PDB site
Description: The structure of RalF
Class: signaling protein
Keywords: Arf guanine nucleotide exchange factor, SIGNALING PROTEIN
Deposited on 2004-10-20, released 2004-11-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: 0.202
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: guanine nucleotide exchange protein
    Species: Legionella pneumophila [TaxId:446]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RT31 (3-354)
      • cloning artifact (0-2)
      • cloning artifact (355)
    Domains in SCOPe 2.03: d1xsza1, d1xsza2
  • Chain 'B':
    Compound: guanine nucleotide exchange protein
    Species: Legionella pneumophila [TaxId:446]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8RT31 (3-354)
      • cloning artifact (0-2)
      • cloning artifact (355)
    Domains in SCOPe 2.03: d1xszb1, d1xszb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xszA (A:)
    gashpeiekaqreiieafnakpknginkikeiceqykispneeiaeffhqqrknldleav
    gdylsspeaenqqvlkaftsqmnfngqsfveglrtflktfklpgeaqkidrlvqsfsgay
    fqqnpdvvsnadaayllafqtimlntdlhnpsipeknkmtvdglkrnlrggnnggdfdak
    fleelyseikakpfelnfvktspgyeltsttlnkdstfkkldsflhstdvnintvfpgig
    dnvkttvdqpkswlsfftgykgtitltdnktsaqatiqvytpnifskwlfgeqprviiqp
    gqtkesidlaakaaadfsspvknfkatydyevgdlikaydnqkklitiernlalka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xszB (B:)
    gashpeiekaqreiieafnakpknginkikeiceqykispneeiaeffhqqrknldleav
    gdylsspeaenqqvlkaftsqmnfngqsfveglrtflktfklpgeaqkidrlvqsfsgay
    fqqnpdvvsnadaayllafqtimlntdlhnpsipeknkmtvdglkrnlrggnnggdfdak
    fleelyseikakpfelnfvktspgyeltsttlnkdstfkkldsflhstdvnintvfpgig
    dnvkttvdqpkswlsfftgykgtitltdnktsaqatiqvytpnifskwlfgeqprviiqp
    gqtkesidlaakaaadfsspvknfkatydyevgdlikaydnqkklitiernlalka