PDB entry 1xsz

View 1xsz on RCSB PDB site
Description: The structure of RalF
Deposited on 2004-10-20, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-02, with a file datestamp of 2004-11-02.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: 0.202
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xszA (A:)
    gashpeiekaqreiieafnakpknginkikeiceqykispneeiaeffhqqrknldleav
    gdylsspeaenqqvlkaftsqmnfngqsfveglrtflktfklpgeaqkidrlvqsfsgay
    fqqnpdvvsnadaayllafqtimlntdlhnpsipeknkmtvdglkrnlrggnnggdfdak
    fleelyseikakpfelnfvktspgyeltsttlnkdstfkkldsflhstdvnintvfpgig
    dnvkttvdqpkswlsfftgykgtitltdnktsaqatiqvytpnifskwlfgeqprviiqp
    gqtkesidlaakaaadfsspvknfkatydyevgdlikaydnqkklitiernlalka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xszB (B:)
    gashpeiekaqreiieafnakpknginkikeiceqykispneeiaeffhqqrknldleav
    gdylsspeaenqqvlkaftsqmnfngqsfveglrtflktfklpgeaqkidrlvqsfsgay
    fqqnpdvvsnadaayllafqtimlntdlhnpsipeknkmtvdglkrnlrggnnggdfdak
    fleelyseikakpfelnfvktspgyeltsttlnkdstfkkldsflhstdvnintvfpgig
    dnvkttvdqpkswlsfftgykgtitltdnktsaqatiqvytpnifskwlfgeqprviiqp
    gqtkesidlaakaaadfsspvknfkatydyevgdlikaydnqkklitiernlalka