PDB entry 1xsw

View 1xsw on RCSB PDB site
Description: The solid-state NMR structure of Kaliotoxin
Class: toxin
Keywords: toxin
Deposited on 2004-10-20, released 2005-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: SOLID-STATENMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kaliotoxin 1
    Species: Androctonus mauretanicus mauretanicus [TaxId:6860]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xswa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xswA (A:)
    gveinvkcsgspqclkpckdagmrfgkcmnrkchctpk