PDB entry 1xsv

View 1xsv on RCSB PDB site
Description: X-ray crystal structure of conserved hypothetical UPF0122 protein SAV1236 from Staphylococcus aureus subsp. aureus Mu50
Class: unknown function
Keywords: helix-turn-helix, putative DNA-binding protein, signal recognition particle, UPF0122, unknown function
Deposited on 2004-10-20, released 2004-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.187
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0122 protein SAV1236
    Species: Staphylococcus aureus [TaxId:46170]
    Gene: SAV1236
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67248 (Start-112)
      • modified residue (14)
      • modified residue (91)
    Domains in SCOPe 2.08: d1xsva_
  • Chain 'B':
    Compound: Hypothetical UPF0122 protein SAV1236
    Species: Staphylococcus aureus [TaxId:46170]
    Gene: SAV1236
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67248 (Start-112)
      • modified residue (14)
      • modified residue (91)
    Domains in SCOPe 2.08: d1xsvb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xsvA (A:)
    gshmgqndlvktlrmnylfdfyqslltnkqrnylelfyledyslseiadtfnvsrqavyd
    nirrtgdlvedyekklelyqkfeqrreiydemkqhlsnpeqiqryiqqledle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xsvA (A:)
    dlvktlrmnylfdfyqslltnkqrnylelfyledyslseiadtfnvsrqavydnirrtgd
    lvedyekklelyqkfeqrreiydemkqhlsnpeqiqryiqqledle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xsvB (B:)
    gshmgqndlvktlrmnylfdfyqslltnkqrnylelfyledyslseiadtfnvsrqavyd
    nirrtgdlvedyekklelyqkfeqrreiydemkqhlsnpeqiqryiqqledle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xsvB (B:)
    dlvktlrmnylfdfyqslltnkqrnylelfyledyslseiadtfnvsrqavydnirrtgd
    lvedyekklelyqkfeqrreiydemkqhlsnpeqiqryiqqledle