PDB entry 1xss

View 1xss on RCSB PDB site
Description: Semi-rational engineering of a green-emitting coral fluorescent protein into an efficient highlighter.
Class: luminescent protein
Keywords: fluorescent protein, LUMINESCENT PROTEIN
Deposited on 2004-10-20, released 2005-03-15
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.197
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fluorescent protein
    Species: Favia favus [TaxId:102203]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53UG7 (0-End)
      • conflict (0)
      • chromophore (63)
    Domains in SCOPe 2.03: d1xssa_
  • Chain 'B':
    Compound: fluorescent protein
    Species: Favia favus [TaxId:102203]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53UG7 (0-226)
      • conflict (0)
      • chromophore (63)
    Domains in SCOPe 2.03: d1xssb_
  • Heterogens: MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xssA (A:)
    vsvitsemkmelrmegavnghkfvitgkgsgqpfegiqnmdltvieggplpfafdilttv
    fdygnrvfvkypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvye
    irfdgvnfpangpvmqrktvkwepstekmyvrdgvlkgdvnmalllqggghyrcdfrtty
    kakkvvqlpdyhfvdhrieitshdkdynkvklyehakahsglprlak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xssA (A:)
    vsvitsemkmelrmegavnghkfvitgkgsgqpfegiqnmdltvieggplpfafdilttv
    fdygnrvfvkypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvye
    irfdgvnfpangpvmqrktvkwepstekmyvrdgvlkgdvnmalllqggghyrcdfrtty
    kakkvvqlpdyhfvdhrieitshdkdynkvklyehakahsglprla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xssB (B:)
    vsvitsemkmelrmegavnghkfvitgkgsgqpfegiqnmdltvieggplpfafdilttv
    fdygnrvfvkypeeivdyfkqsfpegyswersmsyedggiclatnnitmkkdgsncfvye
    irfdgvnfpangpvmqrktvkwepstekmyvrdgvlkgdvnmalllqggghyrcdfrtty
    kakkvvqlpdyhfvdhrieitshdkdynkvklyehakahsglprlak