PDB entry 1xsq

View 1xsq on RCSB PDB site
Description: Crystal structure of ureidoglycolate hydrolase from E.coli. Northeast Structural Genomics Consortium target ET81.
Class: hydrolase
Keywords: Northeast Structural Genomics Consortium, NESG, Structural Genomics, Protein Structure Initiative, PSI, ET81, X-RAY, HYDROLASE
Deposited on 2004-10-19, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.227
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ureidoglycolate hydrolase
    Species: Escherichia coli [TaxId:562]
    Gene: allA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77731 (0-159)
      • modified residue (0)
      • modified residue (83)
    Domains in SCOPe 2.07: d1xsqa_
  • Chain 'B':
    Compound: Ureidoglycolate hydrolase
    Species: Escherichia coli [TaxId:562]
    Gene: allA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77731 (0-159)
      • modified residue (0)
      • modified residue (83)
      • cloning artifact (160)
    Domains in SCOPe 2.07: d1xsqb1, d1xsqb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xsqA (A:)
    mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdctlisinraq
    panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
    nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xsqA (A:)
    mklqvlplsqeafsaygdvietqqrdffhiveryhdlalveileqdctlisinraqpanl
    pltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhrnvwh
    hplfawqrvtdfltidrgdncdvesipeqelcfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xsqB (B:)
    mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdctlisinraq
    panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
    nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xsqB (B:)
    mklqvlplsqeafsaygdvietqqrdffhiveryhdlalveileqdctlisinraqpanl
    pltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhrnvwh
    hplfawqrvtdfltidrgdncdvesipeqelcfal