PDB entry 1xsj

View 1xsj on RCSB PDB site
Description: Structure of a Family 31 alpha glycosidase
Deposited on 2004-10-19, released 2004-10-26
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-26, with a file datestamp of 2004-10-26.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.18
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xsjA (A:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xsjA (A:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xsjB (B:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xsjB (B:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xsjC (C:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xsjC (C:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xsjD (D:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xsjD (D:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xsjE (E:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xsjE (E:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xsjF (F:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xsjF (F:)
    mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
    qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
    dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
    twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
    vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
    hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
    qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
    iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
    gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
    gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
    cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
    vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
    ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh