SCOPe 2.08: Structural Classification of Proteins

PDB entry 1xsi

View 1xsi on RCSB PDB site
Description: Structure of a Family 31 alpha glycosidase
Class: hydrolase
Keywords: beta(8)alpha(8) barrel and beta sandwich domains, hydrolase
Deposited on 2004-10-19, released 2004-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Putative family 31 glucosidase yicI
Species: Escherichia coli [TaxId:562]
Gene: yicI
Database cross-references and differences (RAF-indexed):
- Uniprot P31434 (0-771)
  - expression tag (772)
Domains in SCOPe 2.08: d1xsia1, d1xsia2, d1xsia3, d1xsia4, d1xsia5
Chain 'B':
Compound: Putative family 31 glucosidase yicI
Species: Escherichia coli [TaxId:562]
Gene: yicI
Database cross-references and differences (RAF-indexed):
- Uniprot P31434 (0-771)
  - expression tag (772)
Domains in SCOPe 2.08: d1xsib1, d1xsib2, d1xsib3, d1xsib4, d1xsib5
Chain 'C':
Compound: Putative family 31 glucosidase yicI
Species: Escherichia coli [TaxId:562]
Gene: yicI
Database cross-references and differences (RAF-indexed):
- Uniprot P31434 (0-771)
  - expression tag (772)
Domains in SCOPe 2.08: d1xsic1, d1xsic2, d1xsic3, d1xsic4, d1xsic5
Chain 'D':
Compound: Putative family 31 glucosidase yicI
Species: Escherichia coli [TaxId:562]
Gene: yicI
Database cross-references and differences (RAF-indexed):
- Uniprot P31434 (0-771)
  - expression tag (772)
Domains in SCOPe 2.08: d1xsid1, d1xsid2, d1xsid3, d1xsid4, d1xsid5
Chain 'E':
Compound: Putative family 31 glucosidase yicI
Species: Escherichia coli [TaxId:562]
Gene: yicI
Database cross-references and differences (RAF-indexed):
- Uniprot P31434 (0-771)
  - expression tag (772)
Domains in SCOPe 2.08: d1xsie1, d1xsie2, d1xsie3, d1xsie4, d1xsie5
Chain 'F':
Compound: Putative family 31 glucosidase yicI
Species: Escherichia coli [TaxId:562]
Gene: yicI
Database cross-references and differences (RAF-indexed):
- Uniprot P31434 (0-771)
  - expression tag (772)
Domains in SCOPe 2.08: d1xsif1, d1xsif2, d1xsif3, d1xsif4, d1xsif5
Heterogens: SO4, MPO, ACY, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1xsiA (A:)
mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
vidgptpkavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlpl
hvfhfdcfwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkel
qekgyllkrpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfger
iptdvqwfdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwg
gdcyanyesmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlh
gsksyrvpwayddescdvvrfftqlkcrmmpylyreaaranargtpmmrammmefpddpa
cdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeldgsrwhkqqhgflslp
vyvrdntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartg
ntitvtgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlhhhhhh