PDB entry 1xsf

View 1xsf on RCSB PDB site
Description: Solution structure of a resuscitation promoting factor domain from Mycobacterium tuberculosis
Class: cell cycle, hydrolase
Keywords: lysozyme-like structure, cell cycle, hydrolase
Deposited on 2004-10-19, released 2005-02-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable resuscitation-promoting factor rpfB
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: Rv1009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xsfa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xsfA (A:)
    nvvvtpaheavvrvgtkpgtevppvidgsiwdaiagceaggnwaintgngyyggvqfdqg
    tweangglryapradlatreeqiavaevtrlrqgwgawpvcaaragar