PDB entry 1xsd

View 1xsd on RCSB PDB site
Description: Crystal structure of the BlaI repressor in complex with DNA
Class: transcription/DNA
Keywords: winged helix protein, TRANSCRIPTION/DNA COMPLEX
Deposited on 2004-10-19, released 2005-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Penicillinase repressor
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xsda_
  • Chain 'B':
    Compound: 5'-d(p*tp*ap*cp*tp*ap*cp*ap*tp*ap*tp*gp*tp*ap*gp*tp*a)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xsdA (A:)
    mtnkqveismaewdvmniiwdkksvsaneivveiqkykevsdktirtlitrlykkeiikr
    ykseniyfyssnikeddikmktaktflnklyggdmkslvlnfakneelnnkeieelrdil
    ndiskk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xsdA (A:)
    tnkqveismaewdvmniiwdkksvsaneivveiqkykevsdktirtlitrlykkeiikry
    kseniyfyssnikeddikmktaktflnklyggdmkslvlnfakneelnnkeieelrdiln
    diskk
    

  • Chain 'B':
    No sequence available.