PDB entry 1xsc

View 1xsc on RCSB PDB site
Description: Structure of the nudix enzyme AP4A hydrolase from homo sapiens (E63A mutant) in complex with ATP
Class: hydrolase
Keywords: nudix enzyme, human AP4A ATP hydrolase, NMR, alpha-beta
Deposited on 2004-10-18, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bis(5'-nucleosyl)-tetraphosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50583 (6-151)
      • cloning artifact (0-5)
      • engineered (62)
      • cloning artifact (152)
    Domains in SCOPe 2.07: d1xsca1, d1xsca2, d1xsca3
  • Heterogens: ATP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xscA (A:)
    gplgsmalracgliifrrclipkvdnnaieflllqasdgihhwtppkghvepgeddleta
    lratqeeagieagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayr
    wlgleeacqlaqfkemkaalqeghqflcsieal