PDB entry 1xsb

View 1xsb on RCSB PDB site
Description: structure of the nudix enzyme ap4a hydrolase from homo sapiens (e63a mutant) in complex with atp. no atp restraints included
Deposited on 2004-10-18, released 2004-12-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-21, with a file datestamp of 2004-12-21.
Experiment type: NMR39
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xsba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xsbA (A:)
    gplgsmalracgliifrrclipkvdnnaieflllqasdgihhwtppkghvepgeddleta
    lratqeeagieagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayr
    wlgleeacqlaqfkemkaalqeghqflcsieal