PDB entry 1xs9

View 1xs9 on RCSB PDB site
Description: a model of the ternary complex formed between mara, the alpha-ctd of RNA polymerase and DNA
Class: transcription/DNA
Keywords: protein-DNA complex, ternary complex, mara, RNA polymerase, transcription/DNA complex
Deposited on 2004-10-18, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Multiple antibiotic resistance protein marA
    Species: Escherichia coli [TaxId:562]
    Gene: MARA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xs9a_
  • Chain 'B':
    Compound: 5'-d(p*gp*ap*tp*tp*tp*ap*gp*cp*ap*ap*ap*ap*cp*gp*tp*gp*gp*cp*ap*t)-3'
  • Chain 'C':
    Compound: 5'-d(p*ap*tp*gp*cp*cp*ap*cp*gp*tp*tp*tp*tp*gp*cp*tp*ap*ap*ap*tp*c)-3'
  • Chain 'D':
    Compound: DNA-directed RNA polymerase alpha chain
    Species: Escherichia coli [TaxId:562]
    Gene: rpoA, pez, phs, sez
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xs9A (A:)
    gshmtmsrrntdaitihsildwiednlesplslekvsersgyskwhlqrmfkketghslg
    qyirsrkmteiaqklkesnepilylaerygfesqqtltrtfknyfdvpphkyrmtnmqge
    srflhplnhyns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xs9A (A:)
    mtmsrrntdaitihsildwiednlesplslekvsersgyskwhlqrmfkketghslgqyi
    rsrkmteiaqklkesnepilylaerygfesqqtltrtfknyfdvpphkyrmtnmqgesrf
    lhplnhyns
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.