PDB entry 1xs9

View 1xs9 on RCSB PDB site
Description: a model of the ternary complex formed between mara, the alpha-ctd of RNA polymerase and DNA
Class: transcription/DNA
Keywords: protein-DNA complex, ternary complex, mara, RNA polymerase, transcription/DNA complex
Deposited on 2004-10-18, released 2004-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Multiple antibiotic resistance protein marA
  Species: Escherichia coli [TaxId:562]
  Gene: MARA
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0ACH5 (3-131)
  Domains in SCOPe 2.08: d1xs9a_
• Chain 'B':
  Compound: 5'-d(p*gp*ap*tp*tp*tp*ap*gp*cp*ap*ap*ap*ap*cp*gp*tp*gp*gp*cp*ap*t)-3'
  
• Chain 'C':
  Compound: 5'-d(p*ap*tp*gp*cp*cp*ap*cp*gp*tp*tp*tp*tp*gp*cp*tp*ap*ap*ap*tp*c)-3'
  
• Chain 'D':
  Compound: DNA-directed RNA polymerase alpha chain
  Species: Escherichia coli [TaxId:562]
  Gene: rpoA, pez, phs, sez
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0A7Z4 (3-83)

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1xs9A (A:)
  gshmtmsrrntdaitihsildwiednlesplslekvsersgyskwhlqrmfkketghslg
  qyirsrkmteiaqklkesnepilylaerygfesqqtltrtfknyfdvpphkyrmtnmqge
  srflhplnhyns
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1xs9A (A:)
  mtmsrrntdaitihsildwiednlesplslekvsersgyskwhlqrmfkketghslgqyi
  rsrkmteiaqklkesnepilylaerygfesqqtltrtfknyfdvpphkyrmtnmqgesrf
  lhplnhyns
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.