PDB entry 1xs8

View 1xs8 on RCSB PDB site
Description: Solution Structure of YGGX protein of salmonella enterica
Class: metal transport
Keywords: helix-turn-helix, METAL TRANSPORT
Deposited on 2004-10-18, released 2005-01-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0269 protein yggX
    Species: Salmonella typhimurium [TaxId:602]
    Gene: yggX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P67617 (1-90)
      • initiating methionine (0)
    Domains in SCOPe 2.08: d1xs8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xs8A (A:)
    msrtifctylqrdaegqdfqlypgelgkriyneiskdawaqwqhkqtmlinekklnmmna
    ehrklleqemvsflfegkdvhiegytpedkk