PDB entry 1xs4

View 1xs4 on RCSB PDB site
Description: dCTP deaminase from Escherichia coli- E138A mutant enzyme in complex with dCTP
Class: hydrolase
Keywords: dCTP deaminase, nucleotide metabolism, trimer, hydrolase
Deposited on 2004-10-18, released 2004-12-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.187
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: deoxycytidine triphosphate deaminase
    Species: Escherichia coli [TaxId:562]
    Gene: dcd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28248 (0-192)
      • modified residue (0)
      • modified residue (68)
      • modified residue (118)
      • engineered (137)
      • modified residue (152)
    Domains in SCOPe 2.06: d1xs4a_
  • Chain 'B':
    Compound: deoxycytidine triphosphate deaminase
    Species: Escherichia coli [TaxId:562]
    Gene: dcd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28248 (0-192)
      • modified residue (0)
      • modified residue (68)
      • modified residue (118)
      • engineered (137)
      • modified residue (152)
    Domains in SCOPe 2.06: d1xs4b_
  • Chain 'C':
    Compound: deoxycytidine triphosphate deaminase
    Species: Escherichia coli [TaxId:562]
    Gene: dcd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28248 (0-192)
      • modified residue (0)
      • modified residue (68)
      • modified residue (118)
      • engineered (137)
      • modified residue (152)
    Domains in SCOPe 2.06: d1xs4c_
  • Chain 'D':
    Compound: deoxycytidine triphosphate deaminase
    Species: Escherichia coli [TaxId:562]
    Gene: dcd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28248 (0-192)
      • modified residue (0)
      • modified residue (68)
      • modified residue (118)
      • engineered (137)
      • modified residue (152)
    Domains in SCOPe 2.06: d1xs4d_
  • Chain 'E':
    Compound: deoxycytidine triphosphate deaminase
    Species: Escherichia coli [TaxId:562]
    Gene: dcd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28248 (0-192)
      • modified residue (0)
      • modified residue (68)
      • modified residue (118)
      • engineered (137)
      • modified residue (152)
    Domains in SCOPe 2.06: d1xs4e_
  • Chain 'F':
    Compound: deoxycytidine triphosphate deaminase
    Species: Escherichia coli [TaxId:562]
    Gene: dcd
    Database cross-references and differences (RAF-indexed):
    • Uniprot P28248 (0-192)
      • modified residue (0)
      • modified residue (68)
      • modified residue (118)
      • engineered (137)
      • modified residue (152)
    Domains in SCOPe 2.06: d1xs4f_
  • Heterogens: MG, DCP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xs4A (A:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xs4B (B:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xs4C (C:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xs4D (D:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xs4E (E:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xs4F (F:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd