PDB entry 1xs4

View 1xs4 on RCSB PDB site
Description: dctp deaminase from escherichia coli- e138a mutant enzyme in complex with dctp
Deposited on 2004-10-18, released 2004-12-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-21, with a file datestamp of 2004-12-21.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.187
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xs4a_
  • Chain 'B':
    Domains in SCOP 1.71: d1xs4b_
  • Chain 'C':
    Domains in SCOP 1.71: d1xs4c_
  • Chain 'D':
    Domains in SCOP 1.71: d1xs4d_
  • Chain 'E':
    Domains in SCOP 1.71: d1xs4e_
  • Chain 'F':
    Domains in SCOP 1.71: d1xs4f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xs4A (A:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xs4B (B:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xs4C (C:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xs4D (D:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xs4E (E:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xs4F (F:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd