PDB entry 1xs3

View 1xs3 on RCSB PDB site
Description: Solution Structure Analysis of the XC975 protein
Deposited on 2004-10-18, released 2005-03-29
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein XC975
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1XS3 (0-79)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1xs3A (A:)
    mrkrpldaetirkliesglpearvdvqgedgvhfeatvvspafvgkaplarhrmvyatlg
    elmggaihalqlktltpdea