PDB entry 1xs2

View 1xs2 on RCSB PDB site
Description: Structural Basis for Catalytic Racemization and Substrate Specificity of an N-Acylamino Acid Racemase Homologue from Deinococcus radiodurans
Class: isomerase
Keywords: racemase
Deposited on 2004-10-18, released 2004-11-02
The last revision prior to the SCOP 1.73 freeze date was dated 2004-11-02, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.176
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acylamino acid racemase
    Species: Deinococcus radiodurans
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYA6 (Start-374)
      • see remark 999 (93)
      • see remark 999 (147)
      • see remark 999 (157)
      • see remark 999 (251)
      • see remark 999 (314)
    Domains in SCOP 1.73: d1xs2a1, d1xs2a2
  • Chain 'B':
    Compound: N-acylamino acid racemase
    Species: Deinococcus radiodurans
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYA6 (Start-374)
      • see remark 999 (93)
      • see remark 999 (147)
      • see remark 999 (157)
      • see remark 999 (251)
      • see remark 999 (314)
    Domains in SCOP 1.73: d1xs2b1, d1xs2b2
  • Chain 'C':
    Compound: N-acylamino acid racemase
    Species: Deinococcus radiodurans
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYA6 (Start-374)
      • see remark 999 (93)
      • see remark 999 (147)
      • see remark 999 (157)
      • see remark 999 (251)
      • see remark 999 (314)
    Domains in SCOP 1.73: d1xs2c1, d1xs2c2
  • Chain 'D':
    Compound: N-acylamino acid racemase
    Species: Deinococcus radiodurans
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RYA6 (Start-374)
      • see remark 999 (93)
      • see remark 999 (147)
      • see remark 999 (157)
      • see remark 999 (251)
      • see remark 999 (314)
    Domains in SCOP 1.73: d1xs2d1, d1xs2d2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xs2A (A:)
    mahtgrmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearp
    myreetiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwar
    tlgvplgtllgghkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpv
    ratreafpdirltvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirt
    plcldesvasasdarkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmle
    sgigrahnihlstlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldr
    eflatvteaqeehra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xs2A (A:)
    rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
    gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplgtllgghke
    qvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirltvd
    ansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasasdar
    kalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihlstls
    nfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqeehra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xs2B (B:)
    mahtgrmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearp
    myreetiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwar
    tlgvplgtllgghkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpv
    ratreafpdirltvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirt
    plcldesvasasdarkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmle
    sgigrahnihlstlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldr
    eflatvteaqeehra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xs2B (B:)
    rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
    gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplgtllgghke
    qvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirltvd
    ansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasasdar
    kalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihlstls
    nfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqeehra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xs2C (C:)
    mahtgrmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearp
    myreetiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwar
    tlgvplgtllgghkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpv
    ratreafpdirltvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirt
    plcldesvasasdarkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmle
    sgigrahnihlstlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldr
    eflatvteaqeehra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xs2C (C:)
    rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
    gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplgtllgghke
    qvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirltvd
    ansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasasdar
    kalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihlstls
    nfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqeehra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xs2D (D:)
    mahtgrmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearp
    myreetiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwar
    tlgvplgtllgghkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpv
    ratreafpdirltvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirt
    plcldesvasasdarkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmle
    sgigrahnihlstlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldr
    eflatvteaqeehra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xs2D (D:)
    rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
    gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplgtllgghke
    qvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirltvd
    ansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasasdar
    kalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihlstls
    nfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqeehra