PDB entry 1xs2

View 1xs2 on RCSB PDB site
Description: Structural Basis for Catalytic Racemization and Substrate Specificity of an N-Acylamino Acid Racemase Homologue from Deinococcus radiodurans
Deposited on 2004-10-18, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-02, with a file datestamp of 2004-11-02.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.176
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xs2A (A:)
    mahtgrmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearp
    myreetiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwar
    tlgvplgtllgghkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpv
    ratreafpdirltvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirt
    plcldesvasasdarkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmle
    sgigrahnihlstlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldr
    eflatvteaqeehra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xs2A (A:)
    rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
    gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplgtllgghke
    qvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirltvd
    ansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasasdar
    kalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihlstls
    nfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqeehra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xs2B (B:)
    mahtgrmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearp
    myreetiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwar
    tlgvplgtllgghkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpv
    ratreafpdirltvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirt
    plcldesvasasdarkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmle
    sgigrahnihlstlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldr
    eflatvteaqeehra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xs2B (B:)
    rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
    gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplgtllgghke
    qvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirltvd
    ansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasasdar
    kalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihlstls
    nfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqeehra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xs2C (C:)
    mahtgrmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearp
    myreetiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwar
    tlgvplgtllgghkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpv
    ratreafpdirltvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirt
    plcldesvasasdarkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmle
    sgigrahnihlstlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldr
    eflatvteaqeehra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xs2C (C:)
    rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
    gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplgtllgghke
    qvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirltvd
    ansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasasdar
    kalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihlstls
    nfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqeehra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xs2D (D:)
    mahtgrmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearp
    myreetiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwar
    tlgvplgtllgghkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpv
    ratreafpdirltvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirt
    plcldesvasasdarkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmle
    sgigrahnihlstlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldr
    eflatvteaqeehra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xs2D (D:)
    rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
    gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplgtllgghke
    qvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirltvd
    ansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasasdar
    kalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihlstls
    nfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqeehra