PDB entry 1xs1

View 1xs1 on RCSB PDB site
Description: dctp deaminase from escherichia coli in complex with dutp
Deposited on 2004-10-18, released 2004-12-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-21, with a file datestamp of 2004-12-21.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xs1a_
  • Chain 'B':
    Domains in SCOP 1.71: d1xs1b_
  • Chain 'C':
    Domains in SCOP 1.71: d1xs1c_
  • Chain 'D':
    Domains in SCOP 1.71: d1xs1d_
  • Chain 'E':
    Domains in SCOP 1.71: d1xs1e_
  • Chain 'F':
    Domains in SCOP 1.71: d1xs1f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xs1A (A:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlefynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xs1B (B:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlefynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xs1C (C:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlefynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xs1D (D:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlefynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xs1E (E:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlefynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xs1F (F:)
    mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
    vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
    hvtahridpgwsgcivlefynsgklplalrpgmligalsfeplsgpavrpynrredakyr
    nqqgavasridkd