PDB entry 1xs0

View 1xs0 on RCSB PDB site
Description: Structure of the E. coli Ivy protein
Class: hydrolase inhibitor
Keywords: alpha beta fold, dimer, HYDROLASE INHIBITOR
Deposited on 2004-10-18, released 2004-11-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.225
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inhibitor of vertebrate lysozyme
    Species: Escherichia coli [TaxId:83333]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45502 (Start-127)
      • expression tag (128-129)
    Domains in SCOPe 2.03: d1xs0a_
  • Chain 'B':
    Compound: inhibitor of vertebrate lysozyme
    Species: Escherichia coli [TaxId:83333]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45502 (0-127)
      • expression tag (128)
    Domains in SCOPe 2.03: d1xs0b_
  • Chain 'C':
    Compound: inhibitor of vertebrate lysozyme
    Species: Escherichia coli [TaxId:83333]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45502 (Start-127)
      • expression tag (128-130)
    Domains in SCOPe 2.03: d1xs0c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xs0A (A:)
    qddltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackph
    dcgsqriavmwseksnqmtglfstidektsqekltwlnvndalsidgktvlfaaltgsle
    nhpdgfnfrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xs0A (A:)
    dltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackphdc
    gsqriavmwseksnqmtglfstidektsqekltwlnvndalsidgktvlfaaltgslenh
    pdgfnfrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xs0B (B:)
    qddltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackph
    dcgsqriavmwseksnqmtglfstidektsqekltwlnvndalsidgktvlfaaltgsle
    nhpdgfnfrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xs0B (B:)
    qddltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackph
    dcgsqriavmwseksnqmtglfstidekqekltwlnvndalsidgktvlfaaltgslenh
    pdgfnfr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xs0C (C:)
    qddltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackph
    dcgsqriavmwseksnqmtglfstidektsqekltwlnvndalsidgktvlfaaltgsle
    nhpdgfnfrshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xs0C (C:)
    dltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackphdc
    gsqriavmwseksnqmtglfstidektsqekltwlnvndalsidgktvlfaaltgslenh
    pdgfnfrsh