PDB entry 1xrt

View 1xrt on RCSB PDB site
Description: The Crystal Structure of a Novel, Latent Dihydroorotase from Aquifex Aeolicus at 1.7 A Resolution
Class: hydrolase
Keywords: Dihydroorotase, Amidohydrolase, Metalloenzyme, Pyrimidine, HYDROLASE
Deposited on 2004-10-15, released 2005-07-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.167
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroorotase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: PYRC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1xrta1, d1xrta2
  • Chain 'B':
    Compound: dihydroorotase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: PYRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66990 (45-466)
      • cloning artifact (44)
    Domains in SCOPe 2.06: d1xrtb1, d1xrtb2, d1xrtb3
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xrtA (A:)
    mrfwqyingvdmrgshhhhhhgmasmtggqqmgrdlyddddkdrwmlklivkngyvidps
    qnlegefdilvengkikkidknilvpeaeiidakglivcpgfidihvhlrdpgqtykedi
    esgsrcavaggfttivcmpntnppidnttvvnyilqksksvglcrvlptgtitkgrkgke
    iadfyslkeagcvaftddgspvmdssvmrkalelasqlgvpimdhceddklaygvinege
    vsallglssrapeaeeiqiardgilaqrtgghvhiqhvstklsleiieffkekgvkitce
    vnpnhllfterevlnsganarvnpplrkkedrlaliegvkrgiidcfatdhaphqtfeke
    lvefampgiiglqtalpsalelyrkgiislkkliemftinpariigvdlgtlklgspadi
    tifdpnkewilneetnlsksrntplwgkvlkgkviytikdgkmvykd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrtA (A:)
    mlklivkngyvidpsqnlegefdilvengkikkidknilvpeaeiidakglivcpgfidi
    hvhlrdpgqtykediesgsrcavaggfttivcmpntnppidnttvvnyilqksksvglcr
    vlptgtitkgrkgkeiadfyslkeagcvaftddgspvmdssvmrkalelasqlgvpimdh
    ceddklayaeeiqiardgilaqrtgghvhiqhvstklsleiieffkekgvkitcevnpnh
    lledrlaliegvkrgiidcfatdhaphqtgiiglqtalpsalelyrkgiislkkliemft
    inpariigvdlgtlklgspaditifdpnkewilneetnlsksrntplwgkvlkgkviyti
    kdgkmvykd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xrtB (B:)
    mrfwqyingvdmrgshhhhhhgmasmtggqqmgrdlyddddkdrwmlklivkngyvidps
    qnlegefdilvengkikkidknilvpeaeiidakglivcpgfidihvhlrdpgqtykedi
    esgsrcavaggfttivcmpntnppidnttvvnyilqksksvglcrvlptgtitkgrkgke
    iadfyslkeagcvaftddgspvmdssvmrkalelasqlgvpimdhceddklaygvinege
    vsallglssrapeaeeiqiardgilaqrtgghvhiqhvstklsleiieffkekgvkitce
    vnpnhllfterevlnsganarvnpplrkkedrlaliegvkrgiidcfatdhaphqtfeke
    lvefampgiiglqtalpsalelyrkgiislkkliemftinpariigvdlgtlklgspadi
    tifdpnkewilneetnlsksrntplwgkvlkgkviytikdgkmvykd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrtB (B:)
    wmlklivkngyvidpsqnlegefdilvengkikkidknilvpeaeiidakglivcpgfid
    ihvhlrdpgqtykediesgsrcavaggfttivcmpntnppidnttvvnyilqksksvglc
    rvlptgtitkgrkgkeiadfyslkeagcvaftddgspvmdssvmrkalelasqlgvpimd
    hceddklaeaeeiqiardgilaqrtgghvhiqhvstklsleiieffkekgvkitcevnpn
    hllrlaliegvkrgiidcfatdhaphqtpgiiglqtalpsalelyrkgiislkkliemft
    inpariigvdlgtlklgspaditifdpnkewilneetnlsksrntplwgkvlkgkviyti
    kdgkmvykd