PDB entry 1xrs

View 1xrs on RCSB PDB site
Description: Crystal structure of Lysine 5,6-Aminomutase in complex with PLP, cobalamin, and 5'-deoxyadenosine
Class: isomerase
Keywords: TIM barrel, Rossmann domain, PLP, Cobalamin, B12, 5'-Deoxyadenosine, Radical, mutase, Adenosylcobalamin, Conformational change, ISOMERASE
Deposited on 2004-10-15, released 2004-11-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-lysine 5,6-aminomutase alpha subunit
    Species: Clostridium sticklandii [TaxId:1511]
    Gene: KamDE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xrsa_
  • Chain 'B':
    Compound: D-lysine 5,6-aminomutase beta subunit
    Species: Clostridium sticklandii [TaxId:1511]
    Gene: KamDE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xrsb1, d1xrsb2
  • Heterogens: B12, PLP, 5AD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xrsA (A:)
    mesklnldfnlvekarakakaiaidtqefiekhttvtveravcrllgidgvdtdevplpn
    ivvdhikennglnlgaamyianavlntgktpqeiaqaisageldltklpmkdlfevktka
    lsmaketvekiknnrsiresrfeeygdksgpllyvivatgniyeditqavaaakqgadvi
    avirttgqslldyvpygattegfggtyatqenfrlmrealdkvgaevgkyirlcnycsgl
    cmpeiaamgaierldvmlndalygilfrdinmqrtmidqnfsriingfagviintgedny
    lttadafeeahtvlasqfineqfallaglpeeqmglghafemdpelkngflyelsqaqma
    reifpkaplkympptkfmtgnifkghiqdalfnmvtimtnqrihllgmltealhtpfmsd
    ralsienaqyifnnmesiseeiqfkedgliqkragfvlekanelleeieqlglfdtlekg
    ifggvkrpkdggkglngvvskdenyynpfvelmlnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xrsB (B:)
    mssglysmekkefdkvldlervkpygdtmndgkvqlsftlplknnersaeaakqialkmg
    leepsvvmqqsldeeftffvvygnfvqsvnyneihveavnseilsmeetdeyikenigrk
    ivvvgastgtdahtvgidaimnmkgyaghygleryemidaynlgsqvanedfikkavele
    advllvsqtvtqknvhiqnmthlielleaeglrdrfvllcggprinneiakelgydagfg
    pgrfaddvatfavktlndrmns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrsB (B:)
    kvqlsftlplknnersaeaakqialkmgleepsvvmqqsldeeftffvvygneilsmeet
    deyikenigrkivvvgastgtdahtvgidaimnmkgyaghygleryemidaynlgsqvan
    edfikkaveleadvllvsqtvtqknvhiqnmthlielleaeglrdrfvllcggprinnei
    akelgydagfgpgrfaddvatfavktlndrmn