PDB entry 1xro

View 1xro on RCSB PDB site
Description: Crystal structure of active site F1-mutant E213Q soaked with peptide Phe-Leu
Class: hydrolase
Keywords: alpha-beta hydrolase, caged active site, substrate recognition, hydrogen bonded network, peptide cleavage
Deposited on 2004-10-15, released 2005-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.23
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proline iminopeptidase
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: TA0830
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96084 (Start-292)
      • engineered (212)
    Domains in SCOPe 2.07: d1xroa_
  • Heterogens: LEU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xroA (A:)
    mdqecienyakvngiyiyyklckapeekaklmtmhggpgmshdyllslrdmtkegitvlf
    ydqfgcgrseepdqskftidygveeaealrsklfgnekvflmgssyggalalayavkyqd
    hlkglivsgglssvpltvkemnrlidelpakyrdaikkygssgsyenpeyqeavnyfyhq
    hllrsedwppevlksleyaerrnvyrimngpnqftitgtikdwditdkisaikiptlitv
    geydevtpnvarvihekiagselhvfrdcshltmwedregynkllsdfilkhl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xroA (A:)
    ecienyakvngiyiyyklckapeekaklmtmhggpgmshdyllslrdmtkegitvlfydq
    fgcgrseepdqskftidygveeaealrsklfgnekvflmgssyggalalayavkyqdhlk
    glivsgglssvpltvkemnrlidelpakyrdaikkygssgsyenpeyqeavnyfyhqhll
    rsedwppevlksleyaerrnvyrimngpnqftitgtikdwditdkisaikiptlitvgey
    devtpnvarvihekiagselhvfrdcshltmwedregynkllsdfilkhl