PDB entry 1xrk

View 1xrk on RCSB PDB site
Description: Crystal structure of a mutant bleomycin binding protein from Streptoalloteichus hindustanus displaying increased thermostability
Class: antibiotic inhibitor
Keywords: Arm exchange, Ligand binding protein, Thermostable mutant, ANTIBIOTIC INHIBITOR
Deposited on 2004-10-15, released 2005-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.175
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bleomycin resistance protein
    Species: Streptoalloteichus hindustanus [TaxId:2017]
    Gene: shble
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17493
      • engineered (17)
      • engineered (31)
      • engineered (62)
      • engineered (97)
    Domains in SCOPe 2.08: d1xrka_
  • Chain 'B':
    Compound: bleomycin resistance protein
    Species: Streptoalloteichus hindustanus [TaxId:2017]
    Gene: shble
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17493
      • engineered (17)
      • engineered (31)
      • engineered (62)
      • engineered (97)
    Domains in SCOPe 2.08: d1xrkb_
  • Heterogens: SO4, BLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xrkA (A:)
    makltsavpvltardvaeavefwtdrlgfsrvfveddfagvvrddvtlfisavqdqvvpd
    ntqawvwvrgldelyaewsevvstnfrdasgpamteiveqpwgrefalrdpagncvhfva
    eeqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrkA (A:)
    akltsavpvltardvaeavefwtdrlgfsrvfveddfagvvrddvtlfisavqdqvvpdn
    tqawvwvrgldelyaewsevvstnfrdasgpamteiveqpwgrefalrdpagncvhfvae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xrkB (B:)
    makltsavpvltardvaeavefwtdrlgfsrvfveddfagvvrddvtlfisavqdqvvpd
    ntqawvwvrgldelyaewsevvstnfrdasgpamteiveqpwgrefalrdpagncvhfva
    eeqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrkB (B:)
    akltsavpvltardvaeavefwtdrlgfsrvfveddfagvvrddvtlfisavqdqvvpdn
    tqawvwvrgldelyaewsevvstnfrdasgpamteiveqpwgrefalrdpagncvhfvae
    e