PDB entry 1xrj

View 1xrj on RCSB PDB site
Description: Rapid structure determination of human uridine-cytidine kinase 2 using a conventional laboratory X-ray source and a single samarium derivative
Class: transferase
Keywords: uridine-cytidine kinase, UCK2, nucleoside kinase, oncology, cancer, anti-cancer, rapid phasing, samarium, single-wavelength, anomalous, SIRAS, SAD, TRANSFERASE
Deposited on 2004-10-14, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UCK2, UMPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xrja_
  • Chain 'B':
    Compound: Uridine-cytidine kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: UCK2, UMPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xrjb_
  • Heterogens: MG, C5P, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xrjA (A:)
    magdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkqvvils
    qdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrk
    eetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleq
    ilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpskrqtng
    clngytpsrkrqasesssrph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrjA (A:)
    pfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalkg
    qfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegila
    fysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefclp
    tkkyadviiprgadnlvainlivqhiqdiln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xrjB (B:)
    magdseqtlqnhqqpnggepfligvsggtasgkssvcakivqllgqnevdyrqkqvvils
    qdsfyrvltseqkakalkgqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrk
    eetvtvypadvvlfegilafysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleq
    ilsqyitfvkpafeefclptkkyadviiprgadnlvainlivqhiqdilnggpskrqtng
    clngytpsrkrqasesssrph
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrjB (B:)
    epfligvsggtasgkssvcakivqllgqnevdyrqkqvvilsqdsfyrvltseqkakalk
    gqfnfdhpdafdnelilktlkeitegktvqipvydfvshsrkeetvtvypadvvlfegil
    afysqevrdlfqmklfvdtdadtrlsrrvlrdisergrdleqilsqyitfvkpafeefcl
    ptkkyadviiprgadnlvainlivqhiqdilng