PDB entry 1xri

View 1xri on RCSB PDB site
Description: X-ray structure of a putative phosphoprotein phosphatase from Arabidopsis thaliana gene AT1G05000
Class: structural genomics, unknown function
Keywords: Structural Genomics, Protein Structure Initiative, PSI, CESG, Center for Eukaryotic Structural Genomics, AT1G05000, phosphoprotein phosphatase
Deposited on 2004-10-14, released 2004-10-26
The last revision prior to the SCOP 1.73 freeze date was dated 2005-02-01, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.204
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: At1g05000
  Species: Arabidopsis thaliana
  Gene: At1g05000
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9ZVN4 (0-150)
    • modified residue (9)
    • modified residue (81)
    • modified residue (143)
  Domains in SCOP 1.73: d1xria_
• Chain 'B':
  Compound: At1g05000
  Species: Arabidopsis thaliana
  Gene: At1g05000
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9ZVN4 (0-150)
    • modified residue (9)
    • modified residue (81)
    • modified residue (143)
  Domains in SCOP 1.73: d1xrib_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xriA (A:)
  hlipplnfsmvdngifrsgfpdsanfsflqtlglrsiiylcpepypesnlqflksngirl
  fqfgiegnkepfvnipdhkirmalkvlldeknhpvlihckrgkhrtgclvgclrklqkwc
  ltsifdeyqrfaaakarvsdqrfmeifdvss
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xriB (B:)
  hlipplnfsmvdngifrsgfpdsanfsflqtlglrsiiylcpepypesnlqflksngirl
  fqfgiegnkepfvnipdhkirmalkvlldeknhpvlihckrgkhrtgclvgclrklqkwc
  ltsifdeyqrfaaakarvsdqrfmeifdvss