PDB entry 1xrh

View 1xrh on RCSB PDB site
Description: Crystal Structure of Ureidoglycolate Dehydrogenase from Escherichia Coli
Class: oxidoreductase
Keywords: Structural Genomics; Protein Structure Initiative; NYSGXRC; T1456; ALLD; GLXB8; B0517; Ureidoglycolate dehydrogenase, PSI, New York SGX Research Center for Structural Genomics, OXIDOREDUCTASE
Deposited on 2004-10-14, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.192
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ureidoglycolate Dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: ALLD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77555 (2-End)
      • cloning artifact (1-2)
      • modified residue (93)
      • modified residue (95)
      • modified residue (115)
      • modified residue (138)
      • modified residue (144)
      • modified residue (176)
      • modified residue (194)
      • modified residue (230-232)
      • modified residue (252)
      • modified residue (288)
    Domains in SCOPe 2.07: d1xrha1, d1xrha2
  • Chain 'B':
    Compound: Ureidoglycolate Dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: ALLD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77555 (2-End)
      • cloning artifact (1-2)
      • modified residue (93)
      • modified residue (95)
      • modified residue (115)
      • modified residue (138)
      • modified residue (144)
      • modified residue (176)
      • modified residue (194)
      • modified residue (230-232)
      • modified residue (252)
      • modified residue (288)
    Domains in SCOPe 2.07: d1xrhb1, d1xrhb2
  • Chain 'C':
    Compound: Ureidoglycolate Dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: ALLD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77555 (2-End)
      • cloning artifact (0-2)
      • modified residue (93)
      • modified residue (95)
      • modified residue (115)
      • modified residue (138)
      • modified residue (144)
      • modified residue (176)
      • modified residue (194)
      • modified residue (230-232)
      • modified residue (252)
      • modified residue (288)
    Domains in SCOPe 2.07: d1xrhc1, d1xrhc2
  • Chain 'D':
    Compound: Ureidoglycolate Dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: ALLD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77555 (2-End)
      • cloning artifact (1-2)
      • modified residue (93)
      • modified residue (95)
      • modified residue (115)
      • modified residue (138)
      • modified residue (144)
      • modified residue (176)
      • modified residue (194)
      • modified residue (230-232)
      • modified residue (252)
      • modified residue (288)
    Domains in SCOPe 2.07: d1xrhd1, d1xrhd2
  • Chain 'E':
    Compound: Ureidoglycolate Dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: ALLD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77555 (2-End)
      • cloning artifact (1-2)
      • modified residue (93)
      • modified residue (95)
      • modified residue (115)
      • modified residue (138)
      • modified residue (144)
      • modified residue (176)
      • modified residue (194)
      • modified residue (230-232)
      • modified residue (252)
      • modified residue (288)
    Domains in SCOPe 2.07: d1xrhe1, d1xrhe2
  • Chain 'F':
    Compound: Ureidoglycolate Dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: ALLD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77555 (2-End)
      • cloning artifact (1-2)
      • modified residue (93)
      • modified residue (95)
      • modified residue (115)
      • modified residue (138)
      • modified residue (144)
      • modified residue (176)
      • modified residue (194)
      • modified residue (230-232)
      • modified residue (252)
      • modified residue (288)
    Domains in SCOPe 2.07: d1xrhf1, d1xrhf2
  • Chain 'G':
    Compound: Ureidoglycolate Dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: ALLD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77555 (2-End)
      • cloning artifact (1-2)
      • modified residue (93)
      • modified residue (95)
      • modified residue (115)
      • modified residue (138)
      • modified residue (144)
      • modified residue (176)
      • modified residue (194)
      • modified residue (230-232)
      • modified residue (252)
      • modified residue (288)
    Domains in SCOPe 2.07: d1xrhg1, d1xrhg2
  • Chain 'H':
    Compound: Ureidoglycolate Dehydrogenase
    Species: Escherichia coli [TaxId:562]
    Gene: ALLD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77555 (2-End)
      • cloning artifact (1-2)
      • modified residue (93)
      • modified residue (95)
      • modified residue (115)
      • modified residue (138)
      • modified residue (144)
      • modified residue (176)
      • modified residue (194)
      • modified residue (230-232)
      • modified residue (252)
      • modified residue (288)
    Domains in SCOPe 2.07: d1xrhh1, d1xrhh2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xrhA (A:)
    ssskisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaerisk
    ggtnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsg
    aisyfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmatt
    vqawgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgv
    llglpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapg
    fnqvyypgqdqdikqrkaavegieivddiyqylisdalyntsyetknpfaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrhA (A:)
    sskisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaeriskg
    gtnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsga
    isyfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmattv
    qawgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgvl
    lglpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapgf
    nqvyypgqdqdikqrkaavegieivddiyqylisdalyntsye
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xrhB (B:)
    ssskisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaerisk
    ggtnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsg
    aisyfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmatt
    vqawgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgv
    llglpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapg
    fnqvyypgqdqdikqrkaavegieivddiyqylisdalyntsyetknpfaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrhB (B:)
    sskisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaeriskg
    gtnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsga
    isyfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmattv
    qawgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgvl
    lglpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapgf
    nqvyypgqdqdikqrkaavegieivddiyqylisdalyntsye
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xrhC (C:)
    ssskisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaerisk
    ggtnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsg
    aisyfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmatt
    vqawgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgv
    llglpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapg
    fnqvyypgqdqdikqrkaavegieivddiyqylisdalyntsyetknpfaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrhC (C:)
    ssskisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaerisk
    ggtnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsg
    aisyfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmatt
    vqawgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgv
    llglpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapg
    fnqvyypgqdqdikqrkaavegieivddiyqylisdalyntsye
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xrhD (D:)
    ssskisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaerisk
    ggtnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsg
    aisyfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmatt
    vqawgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgv
    llglpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapg
    fnqvyypgqdqdikqrkaavegieivddiyqylisdalyntsyetknpfaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrhD (D:)
    sskisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaeriskg
    gtnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsga
    isyfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmattv
    qawgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgvl
    lglpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapgf
    nqvyypgqdqdikqrkaavegieivddiyqylisdalyntsy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xrhE (E:)
    ssskisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaerisk
    ggtnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsg
    aisyfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmatt
    vqawgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgv
    llglpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapg
    fnqvyypgqdqdikqrkaavegieivddiyqylisdalyntsyetknpfaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrhE (E:)
    sskisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaeriskg
    gtnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsga
    isyfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmattv
    qawgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgvl
    lglpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapgf
    nqvyypgqdqdikqrkaavegieivddiyqylisdalyntsye
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xrhF (F:)
    ssskisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaerisk
    ggtnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsg
    aisyfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmatt
    vqawgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgv
    llglpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapg
    fnqvyypgqdqdikqrkaavegieivddiyqylisdalyntsyetknpfaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrhF (F:)
    sskisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaeriskg
    gtnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsga
    isyfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmattv
    qawgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgvl
    lglpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapgf
    nqvyypgqdqdikqrkaavegieivddiyqylisdalyn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1xrhG (G:)
    ssskisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaerisk
    ggtnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsg
    aisyfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmatt
    vqawgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgv
    llglpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapg
    fnqvyypgqdqdikqrkaavegieivddiyqylisdalyntsyetknpfaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrhG (G:)
    sskisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaeriskg
    gtnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsga
    isyfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmattv
    qawgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgvl
    lglpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapgf
    nqvyypgqdqdikqrkaavegieivddiyqylisdalynts
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1xrhH (H:)
    ssskisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaerisk
    ggtnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsg
    aisyfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmatt
    vqawgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgv
    llglpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapg
    fnqvyypgqdqdikqrkaavegieivddiyqylisdalyntsyetknpfaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrhH (H:)
    sskisretlhqlienklcqaglkrehaatvaevlvyadargihshgavrveyyaeriskg
    gtnrepefrleetgpcsailhadnaagqvaakmgmehaiktaqqngvavvgisrmghsga
    isyfvqqaaragfigismcqsdpmvvpfggaeiyygtnplafaapgegdeiltfdmattv
    qawgkvldarsrnmsipdtwavdkngvpttdpfavhallpaagpkgyglmmmidvlsgvl
    lglpfgrqvssmyddlhagrnlgqlhivinpnffssselfrqhlsqtmrelnaitpapgf
    nqvyypgqdqdikqrkaavegieivddiyqylisdalyn