PDB entry 1xrg

View 1xrg on RCSB PDB site
Description: Conserved hypothetical protein from Clostridium thermocellum Cth-2968
Class: structural genomics, unknown function
Keywords: conserved hypothetical protein, Clostridium thermocellum, protein structure initiative, PSI, Southeast Collaboratory for Structural Genomics, SECSG, structural genomics, unknown function
Deposited on 2004-10-14, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative translation initiation inhibitor, yjgF family
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00313822 (Start-155)
      • modified residue (112)
    Domains in SCOPe 2.07: d1xrga_
  • Chain 'B':
    Compound: Putative translation initiation inhibitor, yjgF family
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00313822 (30-155)
      • cloning artifact (18-29)
      • modified residue (30)
      • modified residue (112)
    Domains in SCOPe 2.07: d1xrgb1, d1xrgb2
  • Chain 'C':
    Compound: Putative translation initiation inhibitor, yjgF family
    Species: Clostridium thermocellum [TaxId:1515]
    Database cross-references and differences (RAF-indexed):
    • GB ZP_00313822 (30-155)
      • cloning artifact (19-29)
      • modified residue (30)
      • modified residue (112)
    Domains in SCOPe 2.07: d1xrgc1, d1xrgc2
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xrgA (A:)
    mgsshhhhhhssglvprgsqstslykkaglmyievvktnkapeaigpysqaivtgsfvyt
    sgqipinpqtgevvdggieeqakqvlenlknvleaagsslnkvvkttvfikdmdsfakvn
    evyakyfsepyparscvevsklpkgvlieieavaik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrgA (A:)
    yievvktnkapeaigpysqaivtgsfvytsgqipinpqtgevvdggieeqakqvlenlkn
    vleaagsslnkvvkttvfikdmdsfakvnevyakyfsepyparscvevsklpkgvlieie
    avaik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xrgB (B:)
    mgsshhhhhhssglvprgsqstslykkaglmyievvktnkapeaigpysqaivtgsfvyt
    sgqipinpqtgevvdggieeqakqvlenlknvleaagsslnkvvkttvfikdmdsfakvn
    evyakyfsepyparscvevsklpkgvlieieavaik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrgB (B:)
    sqstslykkaglmyievvktnkapeaigpysqaivtgsfvytsgqipinpqtgevvdggi
    eeqakqvlenlknvleaagsslnkvvkttvfikdmdsfakvnevyakyfsepyparscve
    vsklpkgvlieieavaik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xrgC (C:)
    mgsshhhhhhssglvprgsqstslykkaglmyievvktnkapeaigpysqaivtgsfvyt
    sgqipinpqtgevvdggieeqakqvlenlknvleaagsslnkvvkttvfikdmdsfakvn
    evyakyfsepyparscvevsklpkgvlieieavaik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrgC (C:)
    qstslykkaglmyievvktnkapeaigpysqaivtgsfvytsgqipinpqtgevvdggie
    eqakqvlenlknvleaagsslnkvvkttvfikdmdsfakvnevyakyfsepyparscvev
    sklpkgvlieieavaik