PDB entry 1xrf

View 1xrf on RCSB PDB site
Description: The Crystal Structure of a Novel, Latent Dihydroorotase from Aquifex aeolicus at 1.7 A resolution
Class: hydrolase
Keywords: Dihydroorotase, Amidohydrolase, Metalloenzyme, Pyrimidine, HYDROLASE
Deposited on 2004-10-14, released 2005-07-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.179
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroorotase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: PYRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot O66990 (45-466)
      • cloning artifact (44)
    Domains in SCOPe 2.06: d1xrfa1, d1xrfa2, d1xrfa3
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xrfA (A:)
    mrfwqyingvdmrgshhhhhhgmasmtggqqmgrdlyddddkdrwmlklivkngyvidps
    qnlegefdilvengkikkidknilvpeaeiidakglivcpgfidihvhlrdpgqtykedi
    esgsrcavaggfttivcmpntnppidnttvvnyilqksksvglcrvlptgtitkgrkgke
    iadfyslkeagcvaftddgspvmdssvmrkalelasqlgvpimdhceddklaygvinege
    vsallglssrapeaeeiqiardgilaqrtgghvhiqhvstklsleiieffkekgvkitce
    vnpnhllfterevlnsganarvnpplrkkedrlaliegvkrgiidcfatdhaphqtfeke
    lvefampgiiglqtalpsalelyrkgiislkkliemftinpariigvdlgtlklgspadi
    tifdpnkewilneetnlsksrntplwgkvlkgkviytikdgkmvykd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrfA (A:)
    wmlklivkngyvidpsqnlegefdilvengkikkidknilvpeaeiidakglivcpgfid
    ihvhlrdpgqtykediesgsrcavaggfttivcmpntnppidnttvvnyilqksksvglc
    rvlptgtitkgrkgkeiadfyslkeagcvaftddgspvmdssvmrkalelasqlgvpimd
    haeeiqiardgilaqrtgghvhiqhvstklsleiieffkekgvkitcevnpnhlldrlal
    iegvkrgiidcfatdhaphqtmpgiiglqtalpsalelyrkgiislkkliemftinpari
    igvdlgtlklgspaditifdpnkewilneetnlsksrntplwgkvlkgkviytikdgkmv
    ykd