PDB entry 1xrb

View 1xrb on RCSB PDB site
Description: S-adenosylmethionine synthetase (MAT, ATP: L-methionine S-adenosyltransferase, E.C.2.5.1.6) in which MET residues are replaced with selenomethionine residues (MSE)
Deposited on 1995-10-26, released 1996-03-08
The last revision prior to the SCOP 1.57 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.188
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1xrb_ (-)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdinqgvdradpleqgagdqg
    lmfgyatnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgi
    davvlstqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcg
    ltgrkiivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsy
    aigvaeptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghf
    grehfpwektdkaqllrdaaglk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xrb_ (-)
    akhlftsesvseghpdkiadqisdavldaileqdpkarvacetyvktgmvlvggeittsa
    wvdieeitrntvreigyvhsdmgfdanscavlsaigkqspdradpleqgagdqglmfgya
    tnetdvlmpapityahrlvqrqaevrkngtlpwlrpdaksqvtfqyddgkivgidavvls
    tqhseeidqkslqeavmeeiikpilpaewltsatkffinptgrfviggpmgdcgltgrki
    ivdtyggmarhgggafsgkdpskvdrsaayaaryvaknivaagladrceiqvsyaigvae
    ptsimvetfgtekvpseqltllvreffdlrpygliqmldllhpiyketaayghfgrehfp
    wektdkaqllrdaaglk