PDB entry 1xr7

View 1xr7 on RCSB PDB site
Description: Crystal structure of RNA-dependent RNA Polymerase 3D from human rhinovirus serotype 16
Class: transferase
Keywords: RNA-dependent RNA polymerase, transferase
Deposited on 2004-10-13, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.257
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein
    Species: Human rhinovirus A [TaxId:31708]
    Gene: P3D
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82122 (0-459)
      • see remark 999 (148)
    Domains in SCOPe 2.07: d1xr7a_
  • Chain 'B':
    Compound: Genome polyprotein
    Species: Human rhinovirus A [TaxId:31708]
    Gene: P3D
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q82122 (0-459)
      • see remark 999 (148)
    Domains in SCOPe 2.07: d1xr7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xr7A (A:)
    gqiqiskhvkdvglpsihtptktklqpsvfydifpgskepavltekdprlkvdfdsalfs
    kykgntecslnehiqvavahysaqlatldidpqpiamedsvfgmdglealdlntsagypy
    vtlgikkkdlinnktkdisklklaldkygvdlpmitflkdelrkkdkiaagktrvieass
    indtilfrtvygnlfskfhlnpgvvtgcavgcdpetfwskiplmldgdcimafdytnydg
    sihpiwfkalgmvldnlsfnptlinrlcnskhifkstyyeveggvpsgcsgtsifnsmin
    niiirtlvldaykhidldklkiiaygddvifsykykldmeaiakegqkygltitpadkss
    efkeldygnvtflkrgfrqddkykflihptfpveeiyesirwtkkpsqmqehvlslchlm
    whngpeiykdfetkirsvsagralyippyellrhewyekf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xr7B (B:)
    gqiqiskhvkdvglpsihtptktklqpsvfydifpgskepavltekdprlkvdfdsalfs
    kykgntecslnehiqvavahysaqlatldidpqpiamedsvfgmdglealdlntsagypy
    vtlgikkkdlinnktkdisklklaldkygvdlpmitflkdelrkkdkiaagktrvieass
    indtilfrtvygnlfskfhlnpgvvtgcavgcdpetfwskiplmldgdcimafdytnydg
    sihpiwfkalgmvldnlsfnptlinrlcnskhifkstyyeveggvpsgcsgtsifnsmin
    niiirtlvldaykhidldklkiiaygddvifsykykldmeaiakegqkygltitpadkss
    efkeldygnvtflkrgfrqddkykflihptfpveeiyesirwtkkpsqmqehvlslchlm
    whngpeiykdfetkirsvsagralyippyellrhewyekf