PDB entry 1xr6

View 1xr6 on RCSB PDB site
Description: Crystal Structure of RNA-dependent RNA Polymerase 3D from human rhinovirus serotype 1B
Class: transferase
Keywords: RNA-dependent RNA polymerase, transferase
Deposited on 2004-10-13, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.23
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Genome polyprotein
    Species: Human rhinovirus 1B [TaxId:12129]
    Gene: P3D
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12916 (0-459)
      • see remark 999 (42-43)
    Domains in SCOPe 2.07: d1xr6a_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xr6A (A:)
    gqikiskhanecglptihtpsktklqpsvfydvfpgskepavltdndprlkvnfkealfs
    kykgntecslnqhmeiaiahysaqlitldidskpialedsvfgieglealdlntsagfpy
    vtmgikkrdlinnktkdisrlkealdkygvdlpmitflkdelrkkekisagktrvieass
    indtilfrttfgnlfskfhlnpgvvtgsavgcdpetfwskipvmldgdcimafdytnydg
    sihpvwfqalkkvlenlsfqsnlidrlcyskhlfkstyyevaggvpsgcsgtsifntmin
    niiirtlvldayknidldklkiiaygddvifsykytldmeaianegkkygltitpadkst
    efkkldynnvtflkrgfkqdekhtflihptfpveeiyesirwtkkpsqmqehvlslchlm
    whngrkvyedfsskirsvsagralyippydllkhewyekf