PDB entry 1xr4

View 1xr4 on RCSB PDB site
Description: X-ray crystal structure of putative citrate lyase alpha chain/citrate-ACP transferase [Salmonella typhimurium]
Class: hydrolase/transferase
Keywords: The Midwest Center for Structural Genomics, MCSG, structural genomics, protein structure initiative, PSI, citrate lyase, HYDROLASE-TRANSFERASE COMPLEX
Deposited on 2004-10-13, released 2004-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.191
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative citrate lyase alpha chain/citrate-ACP transferase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: CitF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZRY1 (3-End)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (9)
      • modified residue (61)
      • modified residue (78)
      • modified residue (80)
      • modified residue (86)
      • modified residue (135)
      • modified residue (291)
      • modified residue (309)
      • modified residue (366)
      • modified residue (381)
      • modified residue (463)
    Domains in SCOPe 2.07: d1xr4a1, d1xr4a2, d1xr4a3
  • Chain 'B':
    Compound: putative citrate lyase alpha chain/citrate-ACP transferase
    Species: SALMONELLA TYPHIMURIUM [TaxId:99287]
    Gene: CitF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZRY1 (3-End)
      • cloning artifact (2)
      • modified residue (3)
      • modified residue (9)
      • modified residue (61)
      • modified residue (78)
      • modified residue (80)
      • modified residue (86)
      • modified residue (135)
      • modified residue (291)
      • modified residue (309)
      • modified residue (366)
      • modified residue (381)
      • modified residue (463)
    Domains in SCOPe 2.07: d1xr4b1, d1xr4b2, d1xr4b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xr4A (A:)
    snamketvtmlnqqyvvpeglqpyqgvtanspwlasetekrrrkicdsleeairrsglkn
    gmtisfhhafrggdkvvnmvmaklaemgfrdltlassslidahwpliehikngvvrqiyt
    sglrgklgeeisaglmenpvqihshggrvkliqsgelnidvaflgvpccdefgnangfsg
    ksrcgslgyaqvdaqyakcvvllteewvefpnypasiaqdqvdlivqvdevgdpekitag
    airlssnprelliarqaanviehsgyfcdgfslqtgtggaslavtrfledkmrrhnitas
    fglggitgtmvdlhekglikalldtqsfdgdaarslaqnphhieistnqyanpaskgaac
    erlnvvmlsaleidvnfnvnvmtgsngvlrgasgghsdtaagadltiitaplvrgripcv
    vekvlttvtpgasvdvlvtdhgiavnparqdlldnlraagvalmtieqlqqraeqltgkp
    qpieftdrvvavvryrdgsvidvirqvkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xr4A (A:)
    amketvtmlnqqyvvpeglqpyqgvtanspwlasetekrrrkicdsleeairrsglkngm
    tisfhhafrggdkvvnmvmaklaemgfrdltlassslidahwpliehikngvvrqiytsg
    lrgklgeeisaglmenpvqihshggrvkliqsgelnidvaflgvpccdefgnangfsgks
    rcgslgyaqvdaqyakcvvllteewvefpnypasiaqdqvdlivqvdevgdpekitagai
    rlssnprelliarqaanviehsgyfcdgfslqtgtggaslavtrfledkmrrhnitasfg
    lggitgtmvdlhekglikalldtqsfdgdaarslaqnphhieistnqyanpaskgaacer
    lnvvmlsaleidvnfnvnvmtgsngvlrgasgghsdtaagadltiitaplvrgripcvve
    kvlttvtpgasvdvlvtdhgiavnparqdlldnlraagvalmtieqlqqraeqltgkpqp
    ieftdrvvavvryrdgsvidvirqvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xr4B (B:)
    snamketvtmlnqqyvvpeglqpyqgvtanspwlasetekrrrkicdsleeairrsglkn
    gmtisfhhafrggdkvvnmvmaklaemgfrdltlassslidahwpliehikngvvrqiyt
    sglrgklgeeisaglmenpvqihshggrvkliqsgelnidvaflgvpccdefgnangfsg
    ksrcgslgyaqvdaqyakcvvllteewvefpnypasiaqdqvdlivqvdevgdpekitag
    airlssnprelliarqaanviehsgyfcdgfslqtgtggaslavtrfledkmrrhnitas
    fglggitgtmvdlhekglikalldtqsfdgdaarslaqnphhieistnqyanpaskgaac
    erlnvvmlsaleidvnfnvnvmtgsngvlrgasgghsdtaagadltiitaplvrgripcv
    vekvlttvtpgasvdvlvtdhgiavnparqdlldnlraagvalmtieqlqqraeqltgkp
    qpieftdrvvavvryrdgsvidvirqvkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xr4B (B:)
    amketvtmlnqqyvvpeglqpyqgvtanspwlasetekrrrkicdsleeairrsglkngm
    tisfhhafrggdkvvnmvmaklaemgfrdltlassslidahwpliehikngvvrqiytsg
    lrgklgeeisaglmenpvqihshggrvkliqsgelnidvaflgvpccdefgnangfsgks
    rcgslgyaqvdaqyakcvvllteewvefpnypasiaqdqvdlivqvdevgdpekitagai
    rlssnprelliarqaanviehsgyfcdgfslqtgtggaslavtrfledkmrrhnitasfg
    lggitgtmvdlhekglikalldtqsfdgdaarslaqnphhieistnqyanpaskgaacer
    lnvvmlsaleidvnfnvnvmtgsngvlrgasgghsdtaagadltiitaplvrgripcvve
    kvlttvtpgasvdvlvtdhgiavnparqdlldnlraagvalmtieqlqqraeqltgkpqp
    ieftdrvvavvryrdgsvidvirqvk