PDB entry 1xr2

View 1xr2 on RCSB PDB site
Description: crystal structure of oxidized t. maritima cobalamin-independent methionine synthase complexed with methyltetrahydrofolate
Deposited on 2004-10-13, released 2005-03-01
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: metE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X112 (33-End)
      • expression tag (31-32)
  • Chain 'B':
    Compound: 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: metE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X112 (33-End)
      • expression tag (31-32)
  • Heterogens: SO4, C2F, MRY, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1xr2A (A:)
    mhhhhhhgkpipnpllgldstenlyfqgidpftkayafgfpkigekrefkkaledfwkgk
    iteeqfeeemnklrmymvenyrknvdvipsnelsyydfvldtavmvgavperfgeyrgls
    tyfdmarggkalemtkffntnyhylvpeieteefyllenkpledylffkskgietapwvi
    gpftflylskrngewirrpnqmeklleslvsvykevfeklvengckeilvnepafvcdle
    kahwdlilnvyrelsefpltvftyydsvsdyeacvslpvkrlhfdfvsneenlknlekhg
    fpedkklvagvingrqpwkvdlrkvaslveklgasaisnscplfhlpvtlelennlpggl
    keklafakekleelkmlkdflegktfdlpnvsfedfavdlqavervrnlpedsfrrekey
    terdriqrerlnlplfptttigsfpqtpevrkmrskyrkgeiskeeyeafikeqikkaie
    lqeeigldvlvhgefertdmveffaeklngiattqngwvlsygsrcyrppiiygtvtrpe
    pmtlkeityaqsltekpvkgmltgpvtimswsyyredipereiayqialaineevkdlee
    agikivqidepafrekapikkskwpeyfewainafnlaanarpetqihahmcysdfneii
    eyihqlefdvisieasrskgeiisafenfkgwikqigvgvwdihspavpsinemreiver
    vlrvlpkeliwinpdcglktrnwdevipslrnmvalakemrekfes
    

    Sequence, based on observed residues (ATOM records):
    >1xr2A (A:)
    ftkayafgfpkigekrefkkaledfwkgkiteeqfeeemnklrmymvenyrknvdvipsn
    elsyydfvldtavmvgavperfgeyrglstyfdmarggkalemtkffntnyhylvpeiet
    eefyllenkpledylffkskgietapwvigpftflylskrngewirrpnqmeklleslvs
    vykevfeklvengckeilvnepafvcdlekahwdlilnvyrelsefpltvftyydsvsdy
    eacvslpvkrlhfdfvsneenlknlekhgfpedkklvagvingrqpwkvdlrkvaslvek
    lgasaisnscplfhlpvtlelennlpgglkeklafakekleelkmlkdflegktdfavdl
    qavervrnpedsfrrekeyterdriqrerlnlplfptttigsfpqtpevrkmrskiskee
    yeafikeqikkaielqeeigldvlvhgefertdmveffaeklngiattqngwvlsygsrc
    yrppiiygtvtrpepmtlkeityaqsltekpvkgmltgpvtimswsyyredipereiayq
    ialaineevkdleeagikivqidepafrekapikkskwpeyfewainafnlaanarpetq
    ihahmcysdfneiieyihqlefdvisieasrskgeiisafenfkgwikqigvgvwdihsp
    avpsinemreivervlrvlpkeliwinpdcglktrnwdevipslrnmvalakemr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1xr2B (B:)
    mhhhhhhgkpipnpllgldstenlyfqgidpftkayafgfpkigekrefkkaledfwkgk
    iteeqfeeemnklrmymvenyrknvdvipsnelsyydfvldtavmvgavperfgeyrgls
    tyfdmarggkalemtkffntnyhylvpeieteefyllenkpledylffkskgietapwvi
    gpftflylskrngewirrpnqmeklleslvsvykevfeklvengckeilvnepafvcdle
    kahwdlilnvyrelsefpltvftyydsvsdyeacvslpvkrlhfdfvsneenlknlekhg
    fpedkklvagvingrqpwkvdlrkvaslveklgasaisnscplfhlpvtlelennlpggl
    keklafakekleelkmlkdflegktfdlpnvsfedfavdlqavervrnlpedsfrrekey
    terdriqrerlnlplfptttigsfpqtpevrkmrskyrkgeiskeeyeafikeqikkaie
    lqeeigldvlvhgefertdmveffaeklngiattqngwvlsygsrcyrppiiygtvtrpe
    pmtlkeityaqsltekpvkgmltgpvtimswsyyredipereiayqialaineevkdlee
    agikivqidepafrekapikkskwpeyfewainafnlaanarpetqihahmcysdfneii
    eyihqlefdvisieasrskgeiisafenfkgwikqigvgvwdihspavpsinemreiver
    vlrvlpkeliwinpdcglktrnwdevipslrnmvalakemrekfes
    

    Sequence, based on observed residues (ATOM records):
    >1xr2B (B:)
    ftkayafgfpkigekrefkkaledfwkgkiteeqfeeemnklrmymvenyrknvdvipsn
    elsyydfvldtavmvgavperfgeyrglstyfdmarggkalemtkffntnyhylvpeiet
    eefyllenkpledylffkskgietapwvigpftflylskrngewirrpnqmeklleslvs
    vykevfeklvengckeilvnepafvcdlekahwdlilnvyrelsefpltvftyydsvsdy
    eacvslpvkrlhfdfvsneenlknlekgfpedkklvagvingrqpwkvdlrkvaslvekl
    gasaisnscplfhlpvtlelennlpgglkeklafakekleelkmlkdflegktlpnvsfe
    dfavdlqavervrnpedsfrrekeyterdriqrerlnlplfptttigsfpqtpevrkmrs
    kyrkgeiskeeyeafikeqikkaielqeeigldvlvhgefertdmveffaeklngiattq
    ngwvlsygsrcyrppiiygtvtrpepmtlkeityaqsltekpvkgmltgpvtimswsyyr
    edipereiayqialaineevkdleeagikivqidepafrekapikkskwpeyfewainaf
    nlaanarpetqihahmcysdfneiieyihqlefdvisieasrskgeiisafenfkgwikq
    igvgvwdihspavpsinemreivervlrvlpkeliwinpdcglktrnwdevipslrnmva
    lakemrek